Recombinant Human Ribonuclease K6/RNASE6 (C-6His)
Source: Human Cells. MW :15.69kD. Recombinant Human Ribonuclease K6 is produced by our Mammalian expression system and the target gene encoding Trp24-Leu150 is expressed with a 6His tag at the C-terminus. Ribonuclease K6 (RNASE6) is a secreted protein that belongs to the pancreatic ribonuclease family. Human RNASE6 is synthesized as a 150 amino acid precursor that contains a 23 amino acid signal sequence, and a 127 amino acid mature chain. RNASE6 is expressed in many tissues, with high expression levels in the lung, with lower expression levels in the heart, placenta, kidney, pancreas, liver, brain, and skeletal muscle. It is also detected in monocytes and neutrophils. RNASE6 may have a role in host defense.
Product Specifications
Gene Name
RNASE6
Gene ID
6039
UniProt
Q93091
Components
Supplied as a 0.2 μm filtered solution of 20mM TrisHCl,150mM NaCl,1mMDTT,10%Glycerol, pH7.5.
Shipping Conditions
The product is shipped on dry ice/ice packs.
Storage Conditions
Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.
Applications Notes
Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.
Amino Acids
WPKRLTKAHWFEIQHIQPSPLQCNRAMSGINNYTQHCKHQNTFLHDSFQNVAAVCDLLSIVCKNRRHNCHQSSKPVNMTDCRLTSGKYPQCRYSAAAQYKFFIVACDPPQKSDPPYKLVPVHLDSILVDHHHHHH
Explore Other Products
Browse additional items from our catalog