Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Secreted and Transmembrane Protein 1/SECTM1/CD7L/K12 (C-6His)

Source: Human Cells. MW :13.75kD. Recombinant Human Secreted and Transmembrane Protein 1 is produced by our Mammalian expression system and the target gene encoding Gln29-Gly145 is expressed with a 6His tag at the C-terminus. Secreted and Transmembrane Protein 1 (SECTM1) is a transmembrane and secreted protein that belongs to the SECTM family. SECTM1 is expressed in a perinuclear Golgi-like pattern. It is detected at the highest levels in peripheral blood leukocytes and breast cancer cell lines. SECTM1 is considered to participate in thymocyte signaling and the hematopoietic/immune system processes. It is reported that SECTM1 is a broadly expressed, IFN- gamma -inducible molecule, which functions as a potent costimulatory ligand for T cell activation and is synergistic with anti-CD28.

Product Specifications

Gene Name

SECTM1

Gene ID

6398

UniProt

Q8WVN6

Components

Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl, pH7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

QNEGWDSPICTEGVVSVSWGENTVMSCNISNAFSHVNIKLRAHGQESAIFNEVAPGYFSRDGWQLQVQGGVAQLVIKGARDSHAGLYMWHLVGHQRNNRQVTLEVSGAEPQSAPDTGVDHHHHHH

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Wwtr1 Mouse shRNA Lentiviral Particle (Locus ID 97064)
TL505533V 500 µL Each

Wwtr1 Mouse shRNA Lentiviral Particle (Locus ID 97064)

Ask
View Details
PBEF (Pre-B cell Colony Enhancing Factor, Pre-B cell Enhancing Factor, MGC117256, Nicotinamide Phosphoribosyltransferase, NAmPRTase, NAMPT, Pre-B cell Colony Enhancing Factor 1, PBEF1, Visfatin, VF) (Biotin)
P3113-97L3 100 µL

PBEF (Pre-B cell Colony Enhancing Factor, Pre-B cell Enhancing Factor, MGC117256, Nicotinamide Phosphoribosyltransferase, NAmPRTase, NAMPT, Pre-B cell Colony Enhancing Factor 1, PBEF1, Visfatin, VF) (Biotin)

Ask
View Details
PreS2-Ag ELISA test
96 96T/Box

PreS2-Ag ELISA test

Ask
View Details
Chuk, CT (Chuk, Ikka, Inhibitor of nuclear factor kappa-B kinase subunit alpha, Conserved helix-loop-helix ubiquitous kinase, I-kappa-B kinase 1, Nuclear factor NF-kappa-B inhibitor kinase alpha) (MaxLight 490)
MBS6286047-01 0.1 mL

Chuk, CT (Chuk, Ikka, Inhibitor of nuclear factor kappa-B kinase subunit alpha, Conserved helix-loop-helix ubiquitous kinase, I-kappa-B kinase 1, Nuclear factor NF-kappa-B inhibitor kinase alpha) (MaxLight 490)

Ask
View Details
Chuk, CT (Chuk, Ikka, Inhibitor of nuclear factor kappa-B kinase subunit alpha, Conserved helix-loop-helix ubiquitous kinase, I-kappa-B kinase 1, Nuclear factor NF-kappa-B inhibitor kinase alpha) (MaxLight 490)
MBS6286047-02 5x 0.1 mL

Chuk, CT (Chuk, Ikka, Inhibitor of nuclear factor kappa-B kinase subunit alpha, Conserved helix-loop-helix ubiquitous kinase, I-kappa-B kinase 1, Nuclear factor NF-kappa-B inhibitor kinase alpha) (MaxLight 490)

Ask
View Details
Recombinant Clostridium botulinum Aspartate carbamoyltransferase (pyrB)
MBS1156380-01 0.02 mg (E-Coli)

Recombinant Clostridium botulinum Aspartate carbamoyltransferase (pyrB)

Ask
View Details