Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Secreted and Transmembrane Protein 1/SECTM1/CD7L/K12 (C-6His)

Source: Human Cells. MW :13.75kD. Recombinant Human Secreted and Transmembrane Protein 1 is produced by our Mammalian expression system and the target gene encoding Gln29-Gly145 is expressed with a 6His tag at the C-terminus. Secreted and Transmembrane Protein 1 (SECTM1) is a transmembrane and secreted protein that belongs to the SECTM family. SECTM1 is expressed in a perinuclear Golgi-like pattern. It is detected at the highest levels in peripheral blood leukocytes and breast cancer cell lines. SECTM1 is considered to participate in thymocyte signaling and the hematopoietic/immune system processes. It is reported that SECTM1 is a broadly expressed, IFN- gamma -inducible molecule, which functions as a potent costimulatory ligand for T cell activation and is synergistic with anti-CD28.

Product Specifications

Gene Name

SECTM1

Gene ID

6398

UniProt

Q8WVN6

Components

Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl, pH7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

QNEGWDSPICTEGVVSVSWGENTVMSCNISNAFSHVNIKLRAHGQESAIFNEVAPGYFSRDGWQLQVQGGVAQLVIKGARDSHAGLYMWHLVGHQRNNRQVTLEVSGAEPQSAPDTGVDHHHHHH

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human C1GALT1C1 shRNA (UAS) - Lentiviral human C1GALT1C1 shRNA (UAS, RFP) (100)
GTR15094152 1 Vial

Lentiviral human C1GALT1C1 shRNA (UAS) - Lentiviral human C1GALT1C1 shRNA (UAS, RFP) (100)

Sign In for Pricing
View Details
AZD-7648
TRC-A216030-25MG 25 mg

AZD-7648

Sign In for Pricing
View Details
PSTPIP1 Protein Vector (Human) (pPM-C-HA)
38050021 500 ng

PSTPIP1 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
Phytic acid (sodium salt) (Standard)
HY-N2581R 1 Each

Phytic acid (sodium salt) (Standard)

Sign In for Pricing
View Details
SEMA4D Conjugated Antibody
MBS9454590-01 0.1 mL (Biotin)

SEMA4D Conjugated Antibody

Sign In for Pricing
View Details
SEMA4D Conjugated Antibody
MBS9454590-02 0.1 mL (AF350)

SEMA4D Conjugated Antibody

Sign In for Pricing
View Details