Recombinant Human Secreted and Transmembrane Protein 1/SECTM1/CD7L/K12 (C-6His)
Source: Human Cells. MW :13.75kD. Recombinant Human Secreted and Transmembrane Protein 1 is produced by our Mammalian expression system and the target gene encoding Gln29-Gly145 is expressed with a 6His tag at the C-terminus. Secreted and Transmembrane Protein 1 (SECTM1) is a transmembrane and secreted protein that belongs to the SECTM family. SECTM1 is expressed in a perinuclear Golgi-like pattern. It is detected at the highest levels in peripheral blood leukocytes and breast cancer cell lines. SECTM1 is considered to participate in thymocyte signaling and the hematopoietic/immune system processes. It is reported that SECTM1 is a broadly expressed, IFN- gamma -inducible molecule, which functions as a potent costimulatory ligand for T cell activation and is synergistic with anti-CD28.
Product Specifications
Gene Name
SECTM1
Gene ID
6398
UniProt
Q8WVN6
Components
Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl, pH7.4.
Shipping Conditions
The product is shipped at ambient temperature.
Storage Conditions
Applications Notes
Amino Acids
QNEGWDSPICTEGVVSVSWGENTVMSCNISNAFSHVNIKLRAHGQESAIFNEVAPGYFSRDGWQLQVQGGVAQLVIKGARDSHAGLYMWHLVGHQRNNRQVTLEVSGAEPQSAPDTGVDHHHHHH
Explore Other Products
Browse additional items from our catalog