Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Reticulocalbin-3/RCN3 (C-6His)

Source: Human Cells. MW :36.2kD. Recombinant Human Reticulocalbin-3 is produced by our Mammalian expression system and the target gene encoding Lys21-Leu328 is expressed with a 6His tag at the C-terminus. Reticulocalbin-3 is a member of the CREC family that is involved in the secretory pathway. Members of the CREC family consist of a number of multiple EF-hand domains. Reticulocalbin-3 localizes to the endoplasmic reticulum lumen. The bioinformaticanalysis of Reticulocalbin-3 reveal that it is a putative Ca2+-binding protein. In addition, it has been shown that autoactivation and secretion of PACE4 was increased upon co-expression with Reticulocalbin-3. The proPACE4-RCN-3 complex is plays an important role in the biosynthesis of PACE4.

Product Specifications

Gene Name

RCN3

Gene ID

57333

UniProt

Q96D15

Components

Supplied as a 0.2 μm filtered solution of 20mM TrisHCl,150mM NaCl,1mM DTT,10%Glycerol, pH7.4.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

KPSPDAGPHGQGRVHQAAPLSDAPHDDAHGNFQYDHEAFLGREVAKEFDQLTPEESQARLGRIVDRMDRAGDGDGWVSLAELRAWIAHTQQRHIRDSVSAAWDTYDTDRDGRVGWEELRNATYGHYAPGEEFHDVEDAETYKKMLARDERRFRVADQDGDSMATREELTAFLHPEEFPHMRDIVIAETLEDLDRNKDGYVQVEEYIADLYSAEPGEEEPAWVQTERQQFRDFRDLNKDGHLDGSEVGHWVLPPAQDQPLVEANHLLHESDTDKDGRLSKAEILGNWNMFVGSQATNYGEDLTRHHDELVDHHHHHH
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Canine Serum Albumin, Lyophilized
22070049-4 2 g

Canine Serum Albumin, Lyophilized

Ask
View Details
ES (Estrogen) BioAssayTM ELISA Kit discontinued
519228 96 Tests

ES (Estrogen) BioAssayTM ELISA Kit discontinued

Ask
View Details
Recombinant Shewanella denitrificans Guanylate kinase (gmk)
MBS1292723-01 0.02 mg (E-Coli)

Recombinant Shewanella denitrificans Guanylate kinase (gmk)

Ask
View Details
Recombinant Shewanella denitrificans Guanylate kinase (gmk)
MBS1292723-02 0.1 mg (E-Coli)

Recombinant Shewanella denitrificans Guanylate kinase (gmk)

Ask
View Details
Recombinant Shewanella denitrificans Guanylate kinase (gmk)
MBS1292723-03 0.02 mg (Yeast)

Recombinant Shewanella denitrificans Guanylate kinase (gmk)

Ask
View Details
Recombinant Shewanella denitrificans Guanylate kinase (gmk)
MBS1292723-04 0.1 mg (Yeast)

Recombinant Shewanella denitrificans Guanylate kinase (gmk)

Ask
View Details