Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Reticulocalbin-3/RCN3 (C-6His)

Source: Human Cells. MW :36.2kD. Recombinant Human Reticulocalbin-3 is produced by our Mammalian expression system and the target gene encoding Lys21-Leu328 is expressed with a 6His tag at the C-terminus. Reticulocalbin-3 is a member of the CREC family that is involved in the secretory pathway. Members of the CREC family consist of a number of multiple EF-hand domains. Reticulocalbin-3 localizes to the endoplasmic reticulum lumen. The bioinformaticanalysis of Reticulocalbin-3 reveal that it is a putative Ca2+-binding protein. In addition, it has been shown that autoactivation and secretion of PACE4 was increased upon co-expression with Reticulocalbin-3. The proPACE4-RCN-3 complex is plays an important role in the biosynthesis of PACE4.

Product Specifications

Gene Name

RCN3

Gene ID

57333

UniProt

Q96D15

Components

Supplied as a 0.2 μm filtered solution of 20mM TrisHCl,150mM NaCl,1mM DTT,10%Glycerol, pH7.4.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

KPSPDAGPHGQGRVHQAAPLSDAPHDDAHGNFQYDHEAFLGREVAKEFDQLTPEESQARLGRIVDRMDRAGDGDGWVSLAELRAWIAHTQQRHIRDSVSAAWDTYDTDRDGRVGWEELRNATYGHYAPGEEFHDVEDAETYKKMLARDERRFRVADQDGDSMATREELTAFLHPEEFPHMRDIVIAETLEDLDRNKDGYVQVEEYIADLYSAEPGEEEPAWVQTERQQFRDFRDLNKDGHLDGSEVGHWVLPPAQDQPLVEANHLLHESDTDKDGRLSKAEILGNWNMFVGSQATNYGEDLTRHHDELVDHHHHHH
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Anti-RBM25 Antibody
MBS8307896-01 0.03 mL

Anti-RBM25 Antibody

Ask
View Details
Anti-RBM25 Antibody
MBS8307896-02 0.05 mL

Anti-RBM25 Antibody

Ask
View Details
Anti-RBM25 Antibody
MBS8307896-03 0.1 mL

Anti-RBM25 Antibody

Ask
View Details
Anti-RBM25 Antibody
MBS8307896-04 0.2 mL

Anti-RBM25 Antibody

Ask
View Details
Anti-RBM25 Antibody
MBS8307896-05 5x 0.2 mL

Anti-RBM25 Antibody

Ask
View Details
Dyrk1a, CT (Dyrk1a, Dyrk, Dual specificity tyrosine-phosphorylation-regulated kinase 1A, Dual specificity YAK1-related kinase, MP86, Protein kinase minibrain homolog) (MaxLight 550) discontinued
034875-ML550 100 µL

Dyrk1a, CT (Dyrk1a, Dyrk, Dual specificity tyrosine-phosphorylation-regulated kinase 1A, Dual specificity YAK1-related kinase, MP86, Protein kinase minibrain homolog) (MaxLight 550) discontinued

Ask
View Details