Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Reticulocalbin-3/RCN3 (C-6His)

Source: Human Cells. MW :36.2kD. Recombinant Human Reticulocalbin-3 is produced by our Mammalian expression system and the target gene encoding Lys21-Leu328 is expressed with a 6His tag at the C-terminus. Reticulocalbin-3 is a member of the CREC family that is involved in the secretory pathway. Members of the CREC family consist of a number of multiple EF-hand domains. Reticulocalbin-3 localizes to the endoplasmic reticulum lumen. The bioinformaticanalysis of Reticulocalbin-3 reveal that it is a putative Ca2+-binding protein. In addition, it has been shown that autoactivation and secretion of PACE4 was increased upon co-expression with Reticulocalbin-3. The proPACE4-RCN-3 complex is plays an important role in the biosynthesis of PACE4.

Product Specifications

Gene Name

RCN3

Gene ID

57333

UniProt

Q96D15

Components

Supplied as a 0.2 μm filtered solution of 20mM TrisHCl,150mM NaCl,1mM DTT,10%Glycerol, pH7.4.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

KPSPDAGPHGQGRVHQAAPLSDAPHDDAHGNFQYDHEAFLGREVAKEFDQLTPEESQARLGRIVDRMDRAGDGDGWVSLAELRAWIAHTQQRHIRDSVSAAWDTYDTDRDGRVGWEELRNATYGHYAPGEEFHDVEDAETYKKMLARDERRFRVADQDGDSMATREELTAFLHPEEFPHMRDIVIAETLEDLDRNKDGYVQVEEYIADLYSAEPGEEEPAWVQTERQQFRDFRDLNKDGHLDGSEVGHWVLPPAQDQPLVEANHLLHESDTDKDGRLSKAEILGNWNMFVGSQATNYGEDLTRHHDELVDHHHHHH
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Azide Dextrose Broth w/ BCP
M1271-500G 500 g

Azide Dextrose Broth w/ BCP

Ask
View Details
Lentiviral mouse Plekhd1 shRNA (UAS) - Lentiviral mousePlekhd1 shRNA (UAS, GFP) (25)
GTR15290648 1 Vial

Lentiviral mouse Plekhd1 shRNA (UAS) - Lentiviral mousePlekhd1 shRNA (UAS, GFP) (25)

Ask
View Details
OriCell™ Complete Medium For 293T (HEK-293T) Cell Line
CMH4-1401 500 mL

OriCell™ Complete Medium For 293T (HEK-293T) Cell Line

Ask
View Details
pCR-BluntII-TOPO-ZNF430 Plasmid
PVT31116 2 µg

pCR-BluntII-TOPO-ZNF430 Plasmid

Ask
View Details
HSPD1 (60kD Heat Shock Protein, Mitochondrial, 60kD Chaperonin, Chaperonin 60, CPN60, Heat Shock Protein 60, HSP-60, Hsp60, HuCHA60, Mitochondrial Matrix Protein P1, P60 Lymphocyte Protein, HSP60)
140593 200 µL

HSPD1 (60kD Heat Shock Protein, Mitochondrial, 60kD Chaperonin, Chaperonin 60, CPN60, Heat Shock Protein 60, HSP-60, Hsp60, HuCHA60, Mitochondrial Matrix Protein P1, P60 Lymphocyte Protein, HSP60)

Ask
View Details
ZKSCAN5 Rabbit Polyclonal Antibody
TA329411 100 µL

ZKSCAN5 Rabbit Polyclonal Antibody

Ask
View Details