Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Elafin/Trappin-2 (C-6His)

Source: Human Cells. MW :11kD. Recombinant Human Elafin is produced by our Mammalian expression system and the target gene encoding Ala23-Gln117 is expressed with a 6His tag at the C-terminus. Elafin is a secreted protein. Elafin consists of two domains: the transglutaminase substrate domain (cementoin moiety) and the elastase inhibitor domain. The transglutaminase substrate domain serves as an anchor to localize Elafin covalently to specific sites on extracellular matrix proteins. It is shown that Elafin can be used as a biomarker for graft versus host disease of the skin. Elafin is expressed in the skin during wound healing through activation of the epidermal growth factor receptor. Elafin may prevent elastase-mediated tissue proteolysis.

Product Specifications

Gene Name

PI3

Gene ID

5266

UniProt

P19957

Components

Supplied as a 0.2 μm filtered solution of 20mM TrisHCl, 150mM NaCl, pH 7.5.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

AVTGVPVKGQDTVKGRVPFNGQDPVKGQVSVKGQDKVKAQEPVKGPVSTKPGSCPIILIRCAMLNPPNRCLKDTDCPGIKKCCEGSCGMACFVPQVDHHHHHH

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

ADP-Ribosylation Factor-Like 2 Human (Recombinant)
22060779-1 5 µg

ADP-Ribosylation Factor-Like 2 Human (Recombinant)

Ask
View Details
Recombinant Schizosaccharomyces pombe Uncharacterized N-acetyltransferase C18E5.08 (SPBC18E5.08)
MBS1020435-01 0.02 mg (E-Coli)

Recombinant Schizosaccharomyces pombe Uncharacterized N-acetyltransferase C18E5.08 (SPBC18E5.08)

Ask
View Details
Recombinant Schizosaccharomyces pombe Uncharacterized N-acetyltransferase C18E5.08 (SPBC18E5.08)
MBS1020435-02 0.1 mg (E-Coli)

Recombinant Schizosaccharomyces pombe Uncharacterized N-acetyltransferase C18E5.08 (SPBC18E5.08)

Ask
View Details
Recombinant Schizosaccharomyces pombe Uncharacterized N-acetyltransferase C18E5.08 (SPBC18E5.08)
MBS1020435-03 0.02 mg (Yeast)

Recombinant Schizosaccharomyces pombe Uncharacterized N-acetyltransferase C18E5.08 (SPBC18E5.08)

Ask
View Details
Recombinant Schizosaccharomyces pombe Uncharacterized N-acetyltransferase C18E5.08 (SPBC18E5.08)
MBS1020435-04 0.1 mg (Yeast)

Recombinant Schizosaccharomyces pombe Uncharacterized N-acetyltransferase C18E5.08 (SPBC18E5.08)

Ask
View Details
Recombinant Schizosaccharomyces pombe Uncharacterized N-acetyltransferase C18E5.08 (SPBC18E5.08)
MBS1020435-05 0.02 mg (Baculovirus)

Recombinant Schizosaccharomyces pombe Uncharacterized N-acetyltransferase C18E5.08 (SPBC18E5.08)

Ask
View Details