Recombinant Human Elafin/Trappin-2 (C-6His)
Source: Human Cells. MW :11kD. Recombinant Human Elafin is produced by our Mammalian expression system and the target gene encoding Ala23-Gln117 is expressed with a 6His tag at the C-terminus. Elafin is a secreted protein. Elafin consists of two domains: the transglutaminase substrate domain (cementoin moiety) and the elastase inhibitor domain. The transglutaminase substrate domain serves as an anchor to localize Elafin covalently to specific sites on extracellular matrix proteins. It is shown that Elafin can be used as a biomarker for graft versus host disease of the skin. Elafin is expressed in the skin during wound healing through activation of the epidermal growth factor receptor. Elafin may prevent elastase-mediated tissue proteolysis.
Product Specifications
Gene Name
PI3
Gene ID
5266
UniProt
P19957
Components
Supplied as a 0.2 μm filtered solution of 20mM TrisHCl, 150mM NaCl, pH 7.5.
Shipping Conditions
The product is shipped on dry ice/ice packs.
Storage Conditions
Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.
Applications Notes
Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.
Amino Acids
AVTGVPVKGQDTVKGRVPFNGQDPVKGQVSVKGQDKVKAQEPVKGPVSTKPGSCPIILIRCAMLNPPNRCLKDTDCPGIKKCCEGSCGMACFVPQVDHHHHHH
Explore Other Products
Discover premium biology products from our extensive collection of 20M+ items