Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human CD160/BY55 (C-6His)

Source: Human Cells. MW :15.8kD. Recombinant Human CD160 is produced by our Mammalian expression system and the target gene encoding Ile27-Ser159 is expressed with a 6His tag at the C-terminus. CD160 antigen is a Lipid-anchor that exists as a disulfide-linked homomultimer. CD160 contains one Ig-like V-type domain. The human CD160 precursor is a cysteine-rich, glycosylphosphatidylinositol-anchored protein of 181 amino acids with a single Ig-like domain. It is weakly homologous to KIR2DL4. CD160 is expressed in the spleen, peripheral blood, and small intestine. Its expression is tightly associated with peripheral blood NK cells and CD8 T lymphocytes with cytolytic effector activity. CD160 is a receptor showing broad specificity for both classical and non-classical MHC class I molecules.

Product Specifications

Gene Name

CD160

Gene ID

11126

UniProt

O95971

Components

Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl, pH7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

INITSSASQEGTRLNLICTVWHKKEEAEGFVVFLCKDRSGDCSPETSLKQLRLKRDPGIDGVGEISSQLMFTISQVTPLHSGTYQCCARSQKSGIRLQGHFFSILFTETGNYTVTGLKQRQHLEFSHNEGTLSVDHHHHHH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Monoclonal Fluorescein Antibody (4-4-20 (enhanced))
NBP2-81026-0.2mg 0.2 mg

Rat Monoclonal Fluorescein Antibody (4-4-20 (enhanced))

Sign In for Pricing
View Details
PcDNA3.1-Flag-TRPS1
PPL01502-2a 1 Each

PcDNA3.1-Flag-TRPS1

Sign In for Pricing
View Details
Polyclonal BMP2 Antibody (Pro275)
APR03146G 0.05ml

Polyclonal BMP2 Antibody (Pro275)

Sign In for Pricing
View Details
Bovine SNRP70 Antibody
B2016189 50 µg

Bovine SNRP70 Antibody

Sign In for Pricing
View Details
NOTCH3 (NM_000435) Human Mutant ORF Clone
RC402118 10 µg

NOTCH3 (NM_000435) Human Mutant ORF Clone

Sign In for Pricing
View Details
GPS1 Rabbit pAb, Pacific Blue conjugated
orb2890318 100 µL

GPS1 Rabbit pAb, Pacific Blue conjugated

Sign In for Pricing
View Details