Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human CD160/BY55 (C-6His)

Source: Human Cells. MW :15.8kD. Recombinant Human CD160 is produced by our Mammalian expression system and the target gene encoding Ile27-Ser159 is expressed with a 6His tag at the C-terminus. CD160 antigen is a Lipid-anchor that exists as a disulfide-linked homomultimer. CD160 contains one Ig-like V-type domain. The human CD160 precursor is a cysteine-rich, glycosylphosphatidylinositol-anchored protein of 181 amino acids with a single Ig-like domain. It is weakly homologous to KIR2DL4. CD160 is expressed in the spleen, peripheral blood, and small intestine. Its expression is tightly associated with peripheral blood NK cells and CD8 T lymphocytes with cytolytic effector activity. CD160 is a receptor showing broad specificity for both classical and non-classical MHC class I molecules.

Product Specifications

Gene Name

CD160

Gene ID

11126

UniProt

O95971

Components

Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl, pH7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

INITSSASQEGTRLNLICTVWHKKEEAEGFVVFLCKDRSGDCSPETSLKQLRLKRDPGIDGVGEISSQLMFTISQVTPLHSGTYQCCARSQKSGIRLQGHFFSILFTETGNYTVTGLKQRQHLEFSHNEGTLSVDHHHHHH

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

LCN2 Over-expression Lysate Product
GWB-2A56D0 0.1 mg

LCN2 Over-expression Lysate Product

Ask
View Details
Rabbit Polyclonal AF9 Antibody
NBP1-90217 0.1 mL

Rabbit Polyclonal AF9 Antibody

Ask
View Details
Rabbit anti-Ashbya gossypii (strain 10895/CBS 109.51/FGSC 9923/NRRL Y-1056)(Yeast)(Eremothecium gossypii) RPL43 Polyclonal Antibody
MBS7197698 Inquire

Rabbit anti-Ashbya gossypii (strain 10895/CBS 109.51/FGSC 9923/NRRL Y-1056)(Yeast)(Eremothecium gossypii) RPL43 Polyclonal Antibody

Ask
View Details
RYBP ORF Vector (Human) (pORF)
42917011 1.0 µg DNA

RYBP ORF Vector (Human) (pORF)

Ask
View Details
Cathepsin K (CTSK) BioAssayTM ELISA Kit (Mouse)
355056-01 48 Tests

Cathepsin K (CTSK) BioAssayTM ELISA Kit (Mouse)

Ask
View Details
Cathepsin K (CTSK) BioAssayTM ELISA Kit (Mouse)
355056-02 96 Tests

Cathepsin K (CTSK) BioAssayTM ELISA Kit (Mouse)

Ask
View Details