Recombinant Human Ribonuclease Pancreatic/RNASE1 (C-6His)
Source: Human Cells. MW :15.6kD. Recombinant Human Ribonuclease Pancreatic is produced by our Mammalian expression system and the target gene encoding Lys29-Thr156 is expressed with a 6His tag at the C-terminus. Ribonuclease Pancreatic is a secreted enzyme that belongs to the pancreatic ribonuclease family. RNASE1 is an endonuclease that cleaves internal phosphodiester RNA bonds on the 3'-side of pyrimidine bases. RNASE1 prefers poly (C) as a substrate and hydrolyzes 2',3'-cyclic nucleotides, with a pH optimum near 8.0. RNASE1 acts on single stranded and double stranded RNA.
Product Specifications
Gene Name
RNASE1
Gene ID
6035
UniProt
P07998
Components
Supplied as a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, 10% Glycerol, pH 7.4.
Shipping Conditions
The product is shipped on dry ice/ice packs.
Storage Conditions
Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.
Applications Notes
Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.
Amino Acids
KESRAKKFQRQHMDSDSSPSSSSTYCNQMMRRRNMTQGRCKPVNTFVHEPLVDVQNVCFQEKVTCKNGQGNCYKSNSSMHITDCRLTNGSRYPNCAYRTSPKERHIIVACEGSPYVPVHFDASVEDSTVDHHHHHH
Explore Other Products
Discover premium biology products from our extensive collection of 20M+ items