Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Ribonuclease Pancreatic/RNASE1 (C-6His)

Source: Human Cells. MW :15.6kD. Recombinant Human Ribonuclease Pancreatic is produced by our Mammalian expression system and the target gene encoding Lys29-Thr156 is expressed with a 6His tag at the C-terminus. Ribonuclease Pancreatic is a secreted enzyme that belongs to the pancreatic ribonuclease family. RNASE1 is an endonuclease that cleaves internal phosphodiester RNA bonds on the 3'-side of pyrimidine bases. RNASE1 prefers poly (C) as a substrate and hydrolyzes 2',3'-cyclic nucleotides, with a pH optimum near 8.0. RNASE1 acts on single stranded and double stranded RNA.

Product Specifications

Gene Name

RNASE1

Gene ID

6035

UniProt

P07998

Components

Supplied as a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, 10% Glycerol, pH 7.4.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

KESRAKKFQRQHMDSDSSPSSSSTYCNQMMRRRNMTQGRCKPVNTFVHEPLVDVQNVCFQEKVTCKNGQGNCYKSNSSMHITDCRLTNGSRYPNCAYRTSPKERHIIVACEGSPYVPVHFDASVEDSTVDHHHHHH

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Ethyl 5-piperazin-1-ylbenzofuran-2-carboxylate
HY-77058-01 250 mg

Ethyl 5-piperazin-1-ylbenzofuran-2-carboxylate

Ask
View Details
Ethyl 5-piperazin-1-ylbenzofuran-2-carboxylate
HY-77058-02 500 mg

Ethyl 5-piperazin-1-ylbenzofuran-2-carboxylate

Ask
View Details
Ethyl 5-piperazin-1-ylbenzofuran-2-carboxylate
HY-77058-03 1 g

Ethyl 5-piperazin-1-ylbenzofuran-2-carboxylate

Ask
View Details
Ethyl 5-piperazin-1-ylbenzofuran-2-carboxylate
HY-77058-04 5 g

Ethyl 5-piperazin-1-ylbenzofuran-2-carboxylate

Ask
View Details
Ethyl 5-piperazin-1-ylbenzofuran-2-carboxylate
HY-77058-05 10 g

Ethyl 5-piperazin-1-ylbenzofuran-2-carboxylate

Ask
View Details
Ethyl 5-piperazin-1-ylbenzofuran-2-carboxylate
HY-77058-06 25 g

Ethyl 5-piperazin-1-ylbenzofuran-2-carboxylate

Ask
View Details