Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human CD79B/B29 (C-6His)

Source: Human Cells. MW :16.25kD. Recombinant Human CD79B is produced by our Mammalian expression system and the target gene encoding Ala29-Asp159 is expressed with a 6His tag at the C-terminus. CD79B is a single-pass type I membrane protein. CD79B contains one Ig-like V-type domain and one ITAM domain. CD79B is required in cooperation with CD79A for initiation of the signal transduction cascade activated by the B-cell antigen receptor complex (BCR), which leads to internalization of the complex, trafficking to late endosomes and antigen presentation. CD79B enhances phosphorylation of CD79A, possibly by recruiting kinases that phosphorylate CD79A or by recruiting proteins that bind to CD79A and protect it from dephosphorylation.

Product Specifications

Gene Name

CD79B

Gene ID

974

UniProt

P40259

Components

Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl, pH7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

ARSEDRYRNPKGSACSRIWQSPRFIARKRGFTVKMHCYMNSASGNVSWLWKQEMDENPQQLKLEKGRMEESQNESLATLTIQGIRFEDNGIYFCQQKCNNTSEVYQGCGTELRVMGFSTLAQLKQRNTLKDVDHHHHHH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

VEGFR2 protein (Fc Chimera)
30R-AV017 10 ug

VEGFR2 protein (Fc Chimera)

Sign In for Pricing
View Details
Genorise® Rabbit PLA2G7 Polyclonal Antibody
GR180053 100 µg

Genorise® Rabbit PLA2G7 Polyclonal Antibody

Sign In for Pricing
View Details
Rat Zinc Finger and BTB Domain-Containing Protein 20 (ZBTB20) ELISA Kit
MBS9901267-01 48 Well

Rat Zinc Finger and BTB Domain-Containing Protein 20 (ZBTB20) ELISA Kit

Sign In for Pricing
View Details
Rat Zinc Finger and BTB Domain-Containing Protein 20 (ZBTB20) ELISA Kit
MBS9901267-02 96 Well

Rat Zinc Finger and BTB Domain-Containing Protein 20 (ZBTB20) ELISA Kit

Sign In for Pricing
View Details
Rat Zinc Finger and BTB Domain-Containing Protein 20 (ZBTB20) ELISA Kit
MBS9901267-03 5x 96 Well

Rat Zinc Finger and BTB Domain-Containing Protein 20 (ZBTB20) ELISA Kit

Sign In for Pricing
View Details
Rat Zinc Finger and BTB Domain-Containing Protein 20 (ZBTB20) ELISA Kit
MBS9901267-04 10x 96 Well

Rat Zinc Finger and BTB Domain-Containing Protein 20 (ZBTB20) ELISA Kit

Sign In for Pricing
View Details