Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Interleukin-28B/IL-28B/IFN-lambda 3 (C-6His)

Source: Human Cells. MW :20.67kD. Recombinant Human Interleukin-28B is produced by our Mammalian expression system and the target gene encoding Val22-Val196 is expressed with a 6His tag at the C-terminus. Interleukin-28B, also known as Cytokine Zcyto22, Interferon lambda-3, Interferon lambda-4, IFNL3, IFNL4, ZCYTO22 and IL28B, is a secreted cytokine which belongs to the IL-28/IL-29 family. IL-28 has also been shown to play a role in the adaptive immune response. IL28B has immunomodulatory activity and up-regulates MHC class I antigen expression. IL28B displays potent antiviral activity and antitumor activity. In addition, IL28B is a ligand for the heterodimeric class II cytokine receptor composed of IL10RB and IL28RA. The ligand/receptor complex seems to signal through the Jak-STAT pathway.

Product Specifications

Gene Name

IFNL3

Gene ID

282617

UniProt

Q8IZI9

Components

Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl,1mM EDTA, pH7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

VPVARLRGALPDARGCHIAQFKSLSPQELQAFKRAKDALEESLLLKDCKCRSRLFPRTWDLRQLQVRERPVALEAELALTLKVLEATADTDPALGDVLDQPLHTLHHILSQLRACIQPQPTAGPRTRGRLHHWLHRLQEAPKKESPGCLEASVTFNLFRLLTRDLNCVASGDLCVVDHHHHHH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TRIM17 Antibody, Biotin conjugated
CSB-PA897559LD01HU-01 50 µg

TRIM17 Antibody, Biotin conjugated

Sign In for Pricing
View Details
TRIM17 Antibody, Biotin conjugated
CSB-PA897559LD01HU-02 100 µg

TRIM17 Antibody, Biotin conjugated

Sign In for Pricing
View Details
Rasal1 3'UTR Luciferase Stable Cell Line
TU217322 1.0 mL

Rasal1 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
UNC119B Protein Vector (Rat) (pPM-C-HA)
PV314492 500 ng

UNC119B Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing
View Details
1-Boc-4-thiocarbamoylpiperidine
abx180164 10 g

1-Boc-4-thiocarbamoylpiperidine

Sign In for Pricing
View Details
IQ Motif Containing B1 (IQCB1) Antibody
abx324679-01 50 µg

IQ Motif Containing B1 (IQCB1) Antibody

Sign In for Pricing
View Details