Recombinant Human Proline-Rich Acidic Protein 1/PRAP1 (C-6His)
Source: Human Cells. MW :16.04kD. Recombinant Human Proline-Rich Acidic Protein 1 is produced by our Mammalian expression system and the target gene encoding Val21-Gln151 is expressed with a 6His tag at the C-terminus. Proline-rich acidic protein 1, also known as Uterine-specific proline-rich acidic protein, UPA and PRAP1, is a secreted protein. PRAP1 is abundantly expressed in the epithelial cells of the liver, kidney, gastrointestinal tract and cervix. PRAP1 is up-regulated by butyrate, trichostatin A and 5'-aza-2' deoxycytidine. PRAP1 may play an important role in maintaining normal growth homeostasis in epithelial cells. PRAP1 is suppressed through epigenetic mechanisms involving histone deacetylation and methylation. PRAP1 has been shown to cause cell growth inhibition in cancer cell lines.
Product Specifications
Gene Name
PRAP1
Gene ID
118471
UniProt
Q96NZ9
Components
Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl, pH7.4.
Shipping Conditions
The product is shipped at ambient temperature.
Storage Conditions
Applications Notes
Amino Acids
VPAPKVPIKMQVKHWPSEQDPEKAWGARVVEPPEKDDQLVVLFPVQKPKLLTTEEKPRGQGRGPILPGTKAWMETEDTLGRVLSPEPDHDSLYHPPPEEDQGEERPRLWVMPNHQVLLGPEEDQDHIYHPQVDHHHHHH
Explore Other Products
Discover premium biology products from our extensive collection of 20M+ items