Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Proline-Rich Acidic Protein 1/PRAP1 (C-6His)

Source: Human Cells. MW :16.04kD. Recombinant Human Proline-Rich Acidic Protein 1 is produced by our Mammalian expression system and the target gene encoding Val21-Gln151 is expressed with a 6His tag at the C-terminus. Proline-rich acidic protein 1, also known as Uterine-specific proline-rich acidic protein, UPA and PRAP1, is a secreted protein. PRAP1 is abundantly expressed in the epithelial cells of the liver, kidney, gastrointestinal tract and cervix. PRAP1 is up-regulated by butyrate, trichostatin A and 5'-aza-2' deoxycytidine. PRAP1 may play an important role in maintaining normal growth homeostasis in epithelial cells. PRAP1 is suppressed through epigenetic mechanisms involving histone deacetylation and methylation. PRAP1 has been shown to cause cell growth inhibition in cancer cell lines.

Product Specifications

Gene Name

PRAP1

Gene ID

118471

UniProt

Q96NZ9

Components

Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl, pH7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

VPAPKVPIKMQVKHWPSEQDPEKAWGARVVEPPEKDDQLVVLFPVQKPKLLTTEEKPRGQGRGPILPGTKAWMETEDTLGRVLSPEPDHDSLYHPPPEEDQGEERPRLWVMPNHQVLLGPEEDQDHIYHPQVDHHHHHH

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Rat Monoclonal H60 Antibody (205326) [Janelia Fluor 646]
FAB1155J 0.5 mL

Rat Monoclonal H60 Antibody (205326) [Janelia Fluor 646]

Ask
View Details
Rat GALNT10 shRNA Plasmid
abx987579-01 150 µg

Rat GALNT10 shRNA Plasmid

Ask
View Details
Rat GALNT10 shRNA Plasmid
abx987579-02 300 µg

Rat GALNT10 shRNA Plasmid

Ask
View Details
Lentiviral mouse Pon2 shRNA (UAS) - Lentiviral mouse Pon2 shRNA (UAS, iRFP) (25)
GTR15206126 1 Vial

Lentiviral mouse Pon2 shRNA (UAS) - Lentiviral mouse Pon2 shRNA (UAS, iRFP) (25)

Ask
View Details
Recombinant Inhibitor Of Nuclear Factor Kappa B Kinase Interacting Protein (IKBIP)
SIPB919Hu01-01 10 µg

Recombinant Inhibitor Of Nuclear Factor Kappa B Kinase Interacting Protein (IKBIP)

Ask
View Details
Recombinant Inhibitor Of Nuclear Factor Kappa B Kinase Interacting Protein (IKBIP)
SIPB919Hu01-02 50 µg

Recombinant Inhibitor Of Nuclear Factor Kappa B Kinase Interacting Protein (IKBIP)

Ask
View Details