Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human GM-CSF R a/CSF2RA/CD116 (C-6His)

Source: Human Cells. MW :35.5kD. Recombinant Human GM-CSF Receptor alpha is produced by our Mammalian expression system and the target gene encoding Glu23-Gly320 is expressed with a 6His tag at the C-terminus. Granulocyte-Macrophage Colony-Stimulating Factor Receptor Subunit a (CSF2RA) is a single-pass type I membrane protein which belongs to the type I cytokine receptor family of Type 5 subfamily. The CSF2RA gene is found in the pseudoautosomal region (PAR) of the X and Y chromosomes with some of the isoforms being membrane-bound and others being soluble. CSF2RA is a low affinity receptor for granulocyte-macrophage colony-stimulating factor. CSF2RA transduces a signal that results in the proliferation, differentiation, and functional activation of hematopoietic cells. Defects in CSF2RA are the cause of pulmonary surfactant metabolism dysfunction type 4 (SMDP4) .

Product Specifications

Gene Name

CSF2RA

Gene ID

1438

UniProt

P15509

Components

Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl, pH7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

EKSDLRTVAPASSLNVRFDSRTMNLSWDCQENTTFSKCFLTDKKNRVVEPRLSNNECSCTFREICLHEGVTFEVHVNTSQRGFQQKLLYPNSGREGTAAQNFSCFIYNADLMNCTWARGPTAPRDVQYFLYIRNSKRRREIRCPYYIQDSGTHVGCHLDNLSGLTSRNYFLVNGTSREIGIQFFDSLLDTKKIERFNPPSNVTVRCNTTHCLVRWKQPRTYQKLSYLDFQYQLDVHRKNTQPGTENLLINVSGDLENRYNFPSSEPRAKHSVKIRAADVRILNWSSWSEAIEFGSDDGVDHHHHHH
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

DUSP22 Recombinant Protein
32-2293-20 20 µg

DUSP22 Recombinant Protein

Ask
View Details
Recombinant Vibrio cholerae serotype O1 Protease HtpX (htpX), partial
MBS7064544 Inquire

Recombinant Vibrio cholerae serotype O1 Protease HtpX (htpX), partial

Ask
View Details
ZNF670 Mouse Monoclonal Antibody [Clone ID: OTI1F2]
TA811130 100 µL

ZNF670 Mouse Monoclonal Antibody [Clone ID: OTI1F2]

Ask
View Details
Mouse Rnf182 Pre-designed siRNA Set B
SI112101B 1 Each

Mouse Rnf182 Pre-designed siRNA Set B

Ask
View Details
IKAP (IKBKAP) (NM_003640) Human 3' UTR Clone
SC215602 10 µg

IKAP (IKBKAP) (NM_003640) Human 3' UTR Clone

Ask
View Details
Mediator of RNA polymerase II Transcription subunit 29 (MED29) Human ELISA Kit
E9086 96 Tests

Mediator of RNA polymerase II Transcription subunit 29 (MED29) Human ELISA Kit

Ask
View Details