Recombinant Human GM-CSF R a/CSF2RA/CD116 (C-6His)

Source: Human Cells. MW :35.5kD. Recombinant Human GM-CSF Receptor alpha is produced by our Mammalian expression system and the target gene encoding Glu23-Gly320 is expressed with a 6His tag at the C-terminus. Granulocyte-Macrophage Colony-Stimulating Factor Receptor Subunit a (CSF2RA) is a single-pass type I membrane protein which belongs to the type I cytokine receptor family of Type 5 subfamily. The CSF2RA gene is found in the pseudoautosomal region (PAR) of the X and Y chromosomes with some of the isoforms being membrane-bound and others being soluble. CSF2RA is a low affinity receptor for granulocyte-macrophage colony-stimulating factor. CSF2RA transduces a signal that results in the proliferation, differentiation, and functional activation of hematopoietic cells. Defects in CSF2RA are the cause of pulmonary surfactant metabolism dysfunction type 4 (SMDP4) .

Product Specifications

Gene Name

CSF2RA

Gene ID

1438

UniProt

P15509

Components

Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl, pH7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

EKSDLRTVAPASSLNVRFDSRTMNLSWDCQENTTFSKCFLTDKKNRVVEPRLSNNECSCTFREICLHEGVTFEVHVNTSQRGFQQKLLYPNSGREGTAAQNFSCFIYNADLMNCTWARGPTAPRDVQYFLYIRNSKRRREIRCPYYIQDSGTHVGCHLDNLSGLTSRNYFLVNGTSREIGIQFFDSLLDTKKIERFNPPSNVTVRCNTTHCLVRWKQPRTYQKLSYLDFQYQLDVHRKNTQPGTENLLINVSGDLENRYNFPSSEPRAKHSVKIRAADVRILNWSSWSEAIEFGSDDGVDHHHHHH