Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Interleukin-17F/IL-17F (C-6His)

Source: Human Cells. MW :15.96kD. Recombinant Human Interleukin-17F is produced by our Mammalian expression system and the target gene encoding Arg31-Gln163 is expressed with a 6His tag at the C-terminus. Interleukin-17F (IL-17F) exists in a disulfide-linked heterodimer that belongs to the IL-17 family. IL-17F is expressed in activated, but not resting, CD4+ T-cells and activated monocytes. IL-17F has been shown to stimulate the production of several other cytokines, including IL-6, IL-8, and granulocyte colony-stimulating factor. IL-17F can regulate cartilage matrix turnover and stimulates PBMC and T-cell proliferation. IL-17F is also found to inhibit the angiogenesis of endothelial cells and induce endothelial cells to produce IL2, TGFB1/TGFB, and monocyte chemoattractant protein-1. Defects in IL-17F are the cause of familial candidiasis type 6 (CANDF6) .

Product Specifications

Gene Name

IL17F

Gene ID

112744

UniProt

Q96PD4

Components

Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl, pH7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

RKIPKVGHTFFQKPESCPPVPGGSMKLDIGIINENQRVSMSRNIESRSTSPWNYTVTWDPNRYPSEVVQAQCRNLGCINAQGKEDISMNSVPIQQETLVVRRKHQGCSVSFQLEKVLVTVGCTCVTPVIHRVQVDHHHHHH

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Hamster Lathosterol Oxidase (LO) ELISA Kit
MBS9358031-01 48 Well

Hamster Lathosterol Oxidase (LO) ELISA Kit

Ask
View Details
Hamster Lathosterol Oxidase (LO) ELISA Kit
MBS9358031-02 96 Well

Hamster Lathosterol Oxidase (LO) ELISA Kit

Ask
View Details
Hamster Lathosterol Oxidase (LO) ELISA Kit
MBS9358031-03 5x 96 Well

Hamster Lathosterol Oxidase (LO) ELISA Kit

Ask
View Details
Hamster Lathosterol Oxidase (LO) ELISA Kit
MBS9358031-04 10x 96 Well

Hamster Lathosterol Oxidase (LO) ELISA Kit

Ask
View Details
Rabbit anti-SF3a120/SAP114 IHC Antibody, Affinity Purified
IHC-00316-T 0.5 µg

Rabbit anti-SF3a120/SAP114 IHC Antibody, Affinity Purified

Ask
View Details
TCF4 (NM_001243236) Human Untagged Clone
SC330106 10 µg

TCF4 (NM_001243236) Human Untagged Clone

Ask
View Details