Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Sialate O-Acetylesterase/SIAE (C-6His)

Source: Human Cells. MW :57kD. Recombinant Human Sialate O-Acetylesterase is produced by our Mammalian expression system and the target gene encoding Ile24-Lys523 is expressed with a 6His tag at the C-terminus. Sialate O-Acetylesterase (SIAE) belongs to the family of hydrolases, specifically those acting on carboxylic ester bonds. SIAE is widely expressed with high expression levels in the testis, prostate, and colon. SIAE catalyzes N-acetyl-O-acetylneuraminate and H2O to N-acetylneuraminate and acetate. SIAE removes O-acetyl ester groups from position 9 of the parent sialic acid, N-acetylneuraminic acid. SIAE down-regulates B lymphocyte antigen receptor signaling (involving CD22), and is required for immunological tolerance. Loss of function mutations in SIAE are much more frequently found in humans with autoimmune diseases especially rheumatoid arthritis and type 1 diabetes.

Product Specifications

Gene Name

SIAE

Gene ID

54414

UniProt

Q9HAT2

Components

Supplied as a 0.2 μm filtered solution of 20mM TrisHCl,150mM NaCl,10%Glycerol, pH7.5.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

IGFRFASYINNDMVLQKEPAGAVIWGFGTPGATVTVTLRQGQETIMKKVTSVKAHSDTWMVVLDPMKPGGPFEVMAQQTLEKINFTLRVHDVLFGDVWLCSGQSNMQMTVLQIFNATRELSNTAAYQSVRILSVSPIQAEQELEDLVAVDLQWSKPTSENLGHGYFKYMSAVCWLFGRHLYDTLQYPIGLIASSWGGTPIEAWSSGRSLKACGVPKQGSIPYDSVTGPSKHSVLWNAMIHPLCNMTLKGVVWYQGESNINYNTDLYNCTFPALIEDWRETFHRGSQGQTERFFPFGLVQLSSDLSKKSSDDGFPQIRWHQTADFGYVPNPKMPNTFMAVAMDLCDRDSPFGSIHPRDKQTVAYRLHLGARALAYGEKNLTFEGPLPEKIELLAHKGLLNLTYYQQIQVQKKDNKIFEISCCSDHRCKWLPASMNTVSTQSLTLAIDSCHGTVVALRYAWTTWPCEYKQCPLYHPSSALPAPPFIAFITDQGPGHQSNVAKVDHHHHHH
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

NDN (Necdin) (Biotin)
MBS6143114-01 0.1 mL

NDN (Necdin) (Biotin)

Ask
View Details
NDN (Necdin) (Biotin)
MBS6143114-02 5x 0.1 mL

NDN (Necdin) (Biotin)

Ask
View Details
Phospho-RSK2 (Ser369) Peptide
AF7318-BP 1 mg

Phospho-RSK2 (Ser369) Peptide

Ask
View Details
Camel Sex Determining Region Y Box Protein 18 ELISA Kit
MBS104468-01 48 Well

Camel Sex Determining Region Y Box Protein 18 ELISA Kit

Ask
View Details
Camel Sex Determining Region Y Box Protein 18 ELISA Kit
MBS104468-02 96 Well

Camel Sex Determining Region Y Box Protein 18 ELISA Kit

Ask
View Details
Camel Sex Determining Region Y Box Protein 18 ELISA Kit
MBS104468-03 5x 96 Well

Camel Sex Determining Region Y Box Protein 18 ELISA Kit

Ask
View Details