Recombinant Human Interleukin-9/IL-9/Cytokine P40 (C-6His)
Source: Human Cells. MW :15.16kD. Recombinant Human Interleukin-9 is produced by our Mammalian expression system and the target gene encoding Glu19-Ile144 is expressed with a 6His tag at the C-terminus. Interleukin-9 (IL-9) is a secreted protein that belongs to the IL-7/IL-9 family. IL-9 supports IL-2 independent and IL-4 independent growth of helper T-cells. IL-9 stimulates cell proliferation and prevents apoptosis. It functions through the IL-9 receptor (IL-9R), which activates different signal transducer and activator (STAT) proteins and thus connects this cytokine to various biological processes. IL-9 has been identified as a candidate gene for asthma. IL-9 is a determining factor in the pathogenesis of bronchial hyperresponsiveness.
Product Specifications
Gene Name
IL9
Gene ID
3578
UniProt
P15248
Components
Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl, pH7.4.
Shipping Conditions
The product is shipped at ambient temperature.
Storage Conditions
Applications Notes
Amino Acids
QGCPTLAGILDINFLINKMQEDPASKCHCSANVTSCLCLGIPSDNCTRPCFSERLSQMTNTTMQTRYPLIFSRVKKSVEVLKNNKCPYFSCEQPCNQTTAGNALTFLKSLLEIFQKEKMRGMRGKIVDHHHHHH
Frequently Asked Questions
Explore Other Products
Browse additional items from our catalog