Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Lysozyme G-Like Protein 2/LYG2 (C-6His)

Source: Human Cells. MW :22.55kD. Recombinant Human Lysozyme G-Like Protein 2 is produced by our Mammalian expression system and the target gene encoding Ser20-Phe212 is expressed with a 6His tag at the C-terminus. Lysozyme G-Like Protein 2 (LYG2) is a secreted protein that belongs to the glycosyl hydrolase 23 family. LYG2 contains one SLT domain, one protein domain present in bacterial lytic transglycosylase (SLT) and in eukaryotic lysozymes (GEWL) . SLT domain catalyzes the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyglucosamine (GlcNAc) . LYG2 has hydrolase activity which acting on glycosyl bonds, and possess lysozyme activity.

Product Specifications

Gene Name

LYG2

Gene ID

254773

UniProt

Q86SG7

Components

Supplied as a 0.2 μm filtered solution of 20mM PB,150mM NaCl,10%Glycerol, pH7.2.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

SYPFSHSMKPHLHPRLYHGCYGDIMTMKTSGATCDANSVMNCGIRGSEMFAEMDLRAIKPYQTLIKEVGQRHCVDPAVIAAIISRESHGGSVLQDGWDHRGLKFGLMQLDKQTYHPVGAWDSKEHLSQATGILTERIKAIQKKFPTWSVAQHLKGGLSAFKSGIEAIATPSDIDNDFVNDIIARAKFYKRQSFVDHHHHHH
More Discoveries

Explore Other Products

Browse additional items from our catalog

MCPH1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
K2822605 3x 1.0 µg

MCPH1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
Ppp1r3b sgRNA CRISPR Lentivector (Mouse) (Target 1)
K3569402 1.0 µg DNA

Ppp1r3b sgRNA CRISPR Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details
Normal Human IgG Isotype Control Antibody, APC
E55A08044 50 Tests

Normal Human IgG Isotype Control Antibody, APC

Sign In for Pricing
View Details
Bovine Alpha Melanocyte Stimulating Hormone Alpha-MSH ELISA Kit
BG-BVN11555 1 Each

Bovine Alpha Melanocyte Stimulating Hormone Alpha-MSH ELISA Kit

Sign In for Pricing
View Details
Mouse Dpy30 Pre-designed siRNA Set B
SI103886B 1 Each

Mouse Dpy30 Pre-designed siRNA Set B

Sign In for Pricing
View Details
PLXDC2 Protein Vector (Human) (pPB-C-His)
PV031825 500 ng

PLXDC2 Protein Vector (Human) (pPB-C-His)

Sign In for Pricing
View Details