Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Sialidase-1/NEU-1 (C-6His)

Source: Human Cells. MW :41.27kD. Recombinant Human Sialidase-1 is produced by our Mammalian expression system and the target gene encoding Glu48-Leu415 is expressed with a 6His tag at the C-terminus. Sialidase-1 belongs to the N-acetyl-a neuraminidase family. Sialidase-1 is expressed in many tissues; it is highly expressed in the pancreas, and weakly expressed in the brain. Sialidase-1 is a lysosomal enzyme, which cleaves terminal sialic acid residues from substrates such as glycoproteins and glycolipids. Deficiencies in the human enzyme Sialidase-1 leads to sialidosis, a rare lysosomal storage disease. Sialidase-1 has been shown to interact with Cathepsin A (protective protein), beta-galactosidase and N-acetylgalactosamine-6-sulfate sulfatase in a multienzyme complex.

Product Specifications

Gene Name

NEU1

Gene ID

4758

UniProt

Q99519

Components

Supplied as a 0.2 μm filtered solution of 20mM PB,150mM NaCl, pH7.4.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

ENDFGLVQPLVTMEQLLWVSGRQIGSVDTFRIPLITATPRGTLLAFAEARKMSSSDEGAKFIALRRSMDQGSTWSPTAFIVNDGDVPDGLNLGAVVSDVETGVVFLFYSLCAHKAGCQVASTMLVWSKDDGVSWSTPRNLSLDIGTEVFAPGPGSGIQKQREPRKGRLIVCGHGTLERDGVFCLLSDDHGASWRYGSGVSGIPYGQPKQENDFNPDECQPYELPDGSVVINARNQNNYHCHCRIVLRSYDACDTLRPRDVTFDPELVDPVVAAGAVVTSSGIVFFSNPAHPEFRVNLTLRWSFSNGTSWRKETVQLWPGPSGYSSLATLEGSMDGEEQAPQLYVLYEKGRNHYTESISVAKISVYGTLVDHHHHHH
More Discoveries

Explore Other Products

Browse additional items from our catalog

PTPRC (10Z11) Mouse Monoclonal antibody
E28PE1733 100 µL

PTPRC (10Z11) Mouse Monoclonal antibody

Sign In for Pricing
View Details
Rat Monoclonal PBEF/Visfatin/NAMPT Antibody (362616) [DyLight 350]
FAB4044D 0.1 mL

Rat Monoclonal PBEF/Visfatin/NAMPT Antibody (362616) [DyLight 350]

Sign In for Pricing
View Details
Ncapg (NM_019438) Mouse Tagged ORF Clone Lentiviral Particle
MR213656L3V 200 µL

Ncapg (NM_019438) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
TRAV8-7 3'UTR GFP Stable Cell Line
TU076322 1.0 mL

TRAV8-7 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
PAPD7 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)
K2790906 1.0 µg DNA

PAPD7 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
Phospho-mTOR (Ser2448) Rabbit mAb
MBS8603081-01 0.1 mL

Phospho-mTOR (Ser2448) Rabbit mAb

Sign In for Pricing
View Details