Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Sialidase-1/NEU-1 (C-6His)

Source: Human Cells. MW :41.27kD. Recombinant Human Sialidase-1 is produced by our Mammalian expression system and the target gene encoding Glu48-Leu415 is expressed with a 6His tag at the C-terminus. Sialidase-1 belongs to the N-acetyl-a neuraminidase family. Sialidase-1 is expressed in many tissues; it is highly expressed in the pancreas, and weakly expressed in the brain. Sialidase-1 is a lysosomal enzyme, which cleaves terminal sialic acid residues from substrates such as glycoproteins and glycolipids. Deficiencies in the human enzyme Sialidase-1 leads to sialidosis, a rare lysosomal storage disease. Sialidase-1 has been shown to interact with Cathepsin A (protective protein), beta-galactosidase and N-acetylgalactosamine-6-sulfate sulfatase in a multienzyme complex.

Product Specifications

Gene Name

NEU1

Gene ID

4758

UniProt

Q99519

Components

Supplied as a 0.2 μm filtered solution of 20mM PB,150mM NaCl, pH7.4.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

ENDFGLVQPLVTMEQLLWVSGRQIGSVDTFRIPLITATPRGTLLAFAEARKMSSSDEGAKFIALRRSMDQGSTWSPTAFIVNDGDVPDGLNLGAVVSDVETGVVFLFYSLCAHKAGCQVASTMLVWSKDDGVSWSTPRNLSLDIGTEVFAPGPGSGIQKQREPRKGRLIVCGHGTLERDGVFCLLSDDHGASWRYGSGVSGIPYGQPKQENDFNPDECQPYELPDGSVVINARNQNNYHCHCRIVLRSYDACDTLRPRDVTFDPELVDPVVAAGAVVTSSGIVFFSNPAHPEFRVNLTLRWSFSNGTSWRKETVQLWPGPSGYSSLATLEGSMDGEEQAPQLYVLYEKGRNHYTESISVAKISVYGTLVDHHHHHH
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Natriuretic Peptide Receptor C (NPR3) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI4C3]
TA501021BM 100 µL

Natriuretic Peptide Receptor C (NPR3) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI4C3]

Ask
View Details
MYLK4 (NM_001012418) Human Tagged ORF Clone Lentiviral Particle
RC214937L3V 200 µL

MYLK4 (NM_001012418) Human Tagged ORF Clone Lentiviral Particle

Ask
View Details
IFFO (IFFO1) (NM_080730) Human Tagged Lenti ORF Clone
RC221224L4 10 µg

IFFO (IFFO1) (NM_080730) Human Tagged Lenti ORF Clone

Ask
View Details
NOS1AP Antibody, Biotin conjugated
A29843-100UG 100 µg

NOS1AP Antibody, Biotin conjugated

Ask
View Details
VMA HVA 5-HIAA Urine LC-MS/MS Analysis Kit
ZV-3030-0200-20 200 Tests

VMA HVA 5-HIAA Urine LC-MS/MS Analysis Kit

Ask
View Details