Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Early Placenta Insulin-Like Peptide/INSL4/Placentin (C-6His)

Source: Human Cells. MW :13.6kD. Recombinant Human Placentin is produced by our Mammalian expression system and the target gene encoding Ala26-Thr139 is expressed with a 6His tag at the C-terminus. Early Placenta Insulin-Like Peptide (INSL4) belongs to the insulin family. INSL4 is expressed in the early placental cytotrophoblast and syncytiotrophoblast INSL4 is a secreted protein and a precursor that undergoes post-translational cleavage to produce 3 polypeptide chains, A-C, that form tertiary structures composed of either all three chains, or just the A and B chains. INSL4 plays an important role in the development of trophoblast and in the regulation of bone formation.

Product Specifications

Gene Name

INSL4

Gene ID

3641

UniProt

Q14641

Components

Lyophilized from a 0.2 μm filtered solution of 20mM Tris,150mM NACl, pH 8.0.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

AELRGCGPRFGKHLLSYCPMPEKTFTTTPGGWLLESGRPKEMVSTSNNKDGQALGTTSEFIPNLSPELKKPLSEGQPSLKKIILSRKKRSGRHRFDPFCCEVICDDGTSVKLCTVDHHHHHH

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Cadherin like 23 (CDH23) (NM_001171933) Human Tagged ORF Clone
RG230652 10 µg

Cadherin like 23 (CDH23) (NM_001171933) Human Tagged ORF Clone

Ask
View Details
STAT3 Monoclonal antibody, RBITC Conjugated
bsm-33223M-RBITC 100 µL

STAT3 Monoclonal antibody, RBITC Conjugated

Ask
View Details
Lentiviral human FUNDC2 shRNA (UAS) - Lentiviral human FUNDC2 shRNA (UAS, GFP) (100)
GTR15333048 1 Vial

Lentiviral human FUNDC2 shRNA (UAS) - Lentiviral human FUNDC2 shRNA (UAS, GFP) (100)

Ask
View Details
Coumarin-C2-exo-BCN
MF-0159792-01 5 mg

Coumarin-C2-exo-BCN

Ask
View Details
Coumarin-C2-exo-BCN
MF-0159792-02 50 mg

Coumarin-C2-exo-BCN

Ask
View Details
N-Boc-6-Bromohexylamine ≥97% (NMR)
239989-01 250 mg

N-Boc-6-Bromohexylamine ≥97% (NMR)

Ask
View Details