Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Vitamin D-Binding Protein/VDB/Gc-globulin (C-6His)

Source: Human Cells. MW :52.3kD. Recombinant Human Vitamin D-Binding Protein is produced by our Mammalian expression system and the target gene encoding Leu17-Leu474 is expressed with a 6His tag at the C-terminus. Vitamin D-Binding Protein (DBP) is a member of the ALB/AFP/VDB family. DBP is a secreted protein and contains three albumin domains. The primary structure contains 28 cysteine residues forming multiple disulfide bonds. DBP acts as a multifunctional protein found in plasma, ascitic fluid, cerebrospinal fluid, and urine and on the surface of many cell types. DBP binds to vitamin D and its plasma metabolites and transports them to target tissues. DBP associates with membrane-bound immunoglobulin on the surface of B-lymphocytes and with IgG Fc receptor on the membranes of T-lymphocytes.

Product Specifications

Gene Name

GC

Gene ID

2638

UniProt

P02774

Components

Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl, pH7.2.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

LERGRDYEKNKVCKEFSHLGKEDFTSLSLVLYSRKFPSGTFEQVSQLVKEVVSLTEACCAEGADPDCYDTRTSALSAKSCESNSPFPVHPGTAECCTKEGLERKLCMAALKHQPQEFPTYVEPTNDEICEAFRKDPKEYANQFMWEYSTNYGQAPLSLLVSYTKSYLSMVGSCCTSASPTVCFLKERLQLKHLSLLTTLSNRVCSQYAAYGEKKSRLSNLIKLAQKVPTADLEDVLPLAEDITNILSKCCESASEDCMAKELPEHTVKLCDNLSTKNSKFEDCCQEKTAMDVFVCTYFMPAAQLPELPDVELPTNKDVCDPGNTKVMDKYTFELSRRTHLPEVFLSKVLEPTLKSLGECCDVEDSTTCFNAKGPLLKKELSSFIDKGQELCADYSENTFTEYKKKLAERLKAKLPDATPTELAKLVNKRSDFASNCCSINSPPLYCDSEIDAELKNILVDHHHHHH
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

DFF, CT, Blocking Peptide
D3224P 50 µg

DFF, CT, Blocking Peptide

Ask
View Details
Myosin II (in 4% SDS) ex. rabbit skeletal muscle, 95%
57868-01 1 mg

Myosin II (in 4% SDS) ex. rabbit skeletal muscle, 95%

Ask
View Details
Myosin II (in 4% SDS) ex. rabbit skeletal muscle, 95%
57868-02 2 mg

Myosin II (in 4% SDS) ex. rabbit skeletal muscle, 95%

Ask
View Details
TGF beta 1 Recombinant Antibody, APC Conjugated
bsm-61027R-APC-01 20 µL

TGF beta 1 Recombinant Antibody, APC Conjugated

Ask
View Details
TGF beta 1 Recombinant Antibody, APC Conjugated
bsm-61027R-APC-02 100 µL

TGF beta 1 Recombinant Antibody, APC Conjugated

Ask
View Details
N- (2-Fluorophenyl) -3- (2-methoxyphenyl) -2- (2H-tetrazol-5-yl) propanamide
sc-493122 5 mg

N- (2-Fluorophenyl) -3- (2-methoxyphenyl) -2- (2H-tetrazol-5-yl) propanamide

Ask
View Details