Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Porphobilinogen Deaminase/HMBS/PBGD (C-6His)

Source: Human Cells. MW :40.5kD. Recombinant Human Porphobilinogen Deaminase is produced by our Mammalian expression system and the target gene encoding Ser2-His361 is expressed with a 6His tag at the C-terminus. Porphobilinogen Deaminase (HMBS) is a member of the HMBS family. PBGD is the third enzyme of the heme biosynthetic pathway and catalyzes the head to tail condensation of four porphobilinogen molecules into the linear hydroxymethylbilane. HMBS is involved in the production of heme, which is important for all of the body's organs, although it is most abundant in the blood, bone marrow, and liver. In addition, Heme is an essential component of iron-containing proteins called hemoproteins, including hemoglobin. Defects in PBGD are the cause of acute intermittent porphyria.

Product Specifications

Gene Name

HMBS

Gene ID

3145

UniProt

P08397

Components

Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl, pH7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

SGNGNAAATAEENSPKMRVIRVGTRKSQLARIQTDSVVATLKASYPGLQFEIIAMSTTGDKILDTALSKIGEKSLFTKELEHALEKNEVDLVVHSLKDLPTVLPPGFTIGAICKRENPHDAVVFHPKFVGKTLETLPEKSVVGTSSLRRAAQLQRKFPHLEFRSIRGNLNTRLRKLDEQQEFSAIILATAGLQRMGWHNRVGQILHPEECMYAVGQGALGVEVRAKDQDILDLVGVLHDPETLLRCIAERAFLRHLEGGCSVPVAVHTAMKDGQLYLTGGVWSLDGSDSIQETMQATIHVPAQHEDGPEDDPQLVGITARNIPRGPQLAAQNLGISLANLLLSKGAKNILDVARQLNDAHVDHHHHHH
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

ZNF313, CT (RNF114, ZNF228, ZNF313, RING finger protein 114, Zinc finger protein 228, Zinc finger protein 313) (MaxLight 650)
MBS6366159-01 0.1 mL

ZNF313, CT (RNF114, ZNF228, ZNF313, RING finger protein 114, Zinc finger protein 228, Zinc finger protein 313) (MaxLight 650)

Ask
View Details
ZNF313, CT (RNF114, ZNF228, ZNF313, RING finger protein 114, Zinc finger protein 228, Zinc finger protein 313) (MaxLight 650)
MBS6366159-02 5x 0.1 mL

ZNF313, CT (RNF114, ZNF228, ZNF313, RING finger protein 114, Zinc finger protein 228, Zinc finger protein 313) (MaxLight 650)

Ask
View Details
TMEM27 Over-expression Lysate Product
GWB-C2EA76 0.1 mg

TMEM27 Over-expression Lysate Product

Ask
View Details
Epstein-Barr virus
231 100 ug

Epstein-Barr virus

Ask
View Details
WC8 (MaxLight 750) discontinued
W0481-ML750 100 µL

WC8 (MaxLight 750) discontinued

Ask
View Details
DSPE-PEG8 DBCO
MF-0129264-01 10 mg

DSPE-PEG8 DBCO

Ask
View Details