Recombinant Human Golgi Membrane Protein 1/GOLM1 (C-6His)

Source: Human Cells. MW :42.6kD. Recombinant Human Golgi Membrane Protein 1/ is produced by our Mammalian expression system and the target gene encoding Ser35-Leu400 is expressed with a 6His tag at the C-terminus. Golgi Membrane Protein 1 (GOLM1) belongs to the GOLM1/CASC4 family, GOLM1 is a single-pass type II membrane protein and can be found in many tissues . GOLM1 is overexpressed in prostate cancer and lung adenocarcinoma tissue. GOLM1 can be up-regulated in response to viral infection. GOLM1 is induced by the E1A adenoviral protein. GOLM1 plays a key role in the sorting and modification of proteins exported from the endoplasmic reticulum.

Product Specifications

Gene Name

GOLM1

Gene ID

51280

UniProt

Q8NBJ4

Components

Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl, pH7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

SSRSVDLQTRIMELEGRVRRAAAERGAVELKKNEFQGELEKQREQLDKIQSSHNFQLESVNKLYQDEKAVLVNNITTGERLIRVLQDQLKTLQRNYGRLQQDVLQFQKNQTNLERKFSYDLSQCINQMKEVKEQCEERIEEVTKKGNEAVASRDLSENNDQRQQLQALSEPQPRLQAAGLPHTEVPQGKGNVLGNSKSQTPAPSSEVVLDSKRQVEKEETNEIQVVNEEPQRDRLPQEPGREQVVEDRPVGGRGFGGAGELGQTPQVQAALSVSQENPEMEGPERDQLVIPDGQEEEQEAAGEGRNQQKLRGEDDYNMDENEAESETDKQAALAGNDRNIDVFNVEDQKRDTINLLDQREKRNHTLVDHHHHHH