Recombinant Human Pro-Neuropeptide Y/NPY (C-6His)
Source: Human Cells. MW :9.1kD. Recombinant Human Pro-Neuropeptide Y is produced by our Mammalian expression system and the target gene encoding Tyr29-Trp97 is expressed with a 6His tag at the C-terminus. Pro-Neuropeptide Y (NPY) is a member of the NPY family. NPY is a secreted protein and is one of the most abundant peptides in the nervous system. It also can be found in some chromaffin cells of the adrenal medulla. NPY can be cleaved into Neuropeptide Y and C-flanking peptide of NPY chain, which regulates energy usage, and it is involved in learning, memory processing, and epilepsy. NPY is implicated in the control of feeding and in secretion of gonadotrophin-release hormone. In addition, NPY increases the proportion of energy stored as fat and blocks nociceptive signals to the brain.
Product Specifications
Gene Name
NPY
Gene ID
4852
UniProt
P01303
Components
Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl, pH7.4.
Shipping Conditions
The product is shipped at ambient temperature.
Storage Conditions
Applications Notes
Amino Acids
YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRYGKRSSPETLISDLLMRESTENVPRTRLEDPAMWVDHHHHHH
Explore Other Products
Discover premium biology products from our extensive collection of 20M+ items