Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Pro-Neuropeptide Y/NPY (C-6His)

Source: Human Cells. MW :9.1kD. Recombinant Human Pro-Neuropeptide Y is produced by our Mammalian expression system and the target gene encoding Tyr29-Trp97 is expressed with a 6His tag at the C-terminus. Pro-Neuropeptide Y (NPY) is a member of the NPY family. NPY is a secreted protein and is one of the most abundant peptides in the nervous system. It also can be found in some chromaffin cells of the adrenal medulla. NPY can be cleaved into Neuropeptide Y and C-flanking peptide of NPY chain, which regulates energy usage, and it is involved in learning, memory processing, and epilepsy. NPY is implicated in the control of feeding and in secretion of gonadotrophin-release hormone. In addition, NPY increases the proportion of energy stored as fat and blocks nociceptive signals to the brain.

Product Specifications

Gene Name

NPY

Gene ID

4852

UniProt

P01303

Components

Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl, pH7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRYGKRSSPETLISDLLMRESTENVPRTRLEDPAMWVDHHHHHH

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

APC Linked Polyclonal Antibody to Histone H3 (H3)
MBS2129110-01 0.1 mL

APC Linked Polyclonal Antibody to Histone H3 (H3)

Ask
View Details
APC Linked Polyclonal Antibody to Histone H3 (H3)
MBS2129110-02 0.2 mL

APC Linked Polyclonal Antibody to Histone H3 (H3)

Ask
View Details
APC Linked Polyclonal Antibody to Histone H3 (H3)
MBS2129110-03 0.5 mL

APC Linked Polyclonal Antibody to Histone H3 (H3)

Ask
View Details
APC Linked Polyclonal Antibody to Histone H3 (H3)
MBS2129110-04 1 mL

APC Linked Polyclonal Antibody to Histone H3 (H3)

Ask
View Details
APC Linked Polyclonal Antibody to Histone H3 (H3)
MBS2129110-05 5 mL

APC Linked Polyclonal Antibody to Histone H3 (H3)

Ask
View Details
APC Linked Polyclonal Antibody to Histone H3 (H3)
MBS2129110-06 5x 5 mL

APC Linked Polyclonal Antibody to Histone H3 (H3)

Ask
View Details