Recombinant Human CEACAM7/CGM2 (C-6His)
Source: Human Cells. MW :13.1kD. Recombinant Human CEACAM7 is produced by our Mammalian expression system and the target gene encoding Thr36-Phe142 is expressed with a 6His tag at the C-terminus. Carcinoembryonic Antigen-Related Cell Adhesion Molecule 7 (CEACAM7) is a member of the immunoglobulin superfamily A and CEA family. CEACAM7 localizes to the cell membrane and contains one Ig-like C2-type domain and one Ig-like V-type domain. The expression of CEACAM7 is significantly decreased in rectal cancer. Differences in CEACAM7 expression levels between long-term survivors and those with recurrent disease introduce a potential tumor marker to define a subset of patients who benefit most from adjuvant therapy.
Product Specifications
Gene Name
CEACAM7
Gene ID
1087
UniProt
Q14002
Components
Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl, pH7.4.
Shipping Conditions
The product is shipped at ambient temperature.
Storage Conditions
Applications Notes
Amino Acids
TNIDVVPFNVAEGKEVLLVVHNESQNLYGYNWYKGERVHANYRIIGYVKNISQENAPGPAHNGRETIYPNGTLLIQNVTHNDAGIYTLHVIKENLVNEEVTRQFYVFVDHHHHHH
Explore Other Products
Discover premium biology products from our extensive collection of 20M+ items