Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human CEACAM7/CGM2 (C-6His)

Source: Human Cells. MW :13.1kD. Recombinant Human CEACAM7 is produced by our Mammalian expression system and the target gene encoding Thr36-Phe142 is expressed with a 6His tag at the C-terminus. Carcinoembryonic Antigen-Related Cell Adhesion Molecule 7 (CEACAM7) is a member of the immunoglobulin superfamily A and CEA family. CEACAM7 localizes to the cell membrane and contains one Ig-like C2-type domain and one Ig-like V-type domain. The expression of CEACAM7 is significantly decreased in rectal cancer. Differences in CEACAM7 expression levels between long-term survivors and those with recurrent disease introduce a potential tumor marker to define a subset of patients who benefit most from adjuvant therapy.

Product Specifications

Gene Name

CEACAM7

Gene ID

1087

UniProt

Q14002

Components

Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl, pH7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

TNIDVVPFNVAEGKEVLLVVHNESQNLYGYNWYKGERVHANYRIIGYVKNISQENAPGPAHNGRETIYPNGTLLIQNVTHNDAGIYTLHVIKENLVNEEVTRQFYVFVDHHHHHH

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

TTC4P1 Adenovirus (Human)
48703051 1.0 mL

TTC4P1 Adenovirus (Human)

Ask
View Details
SENP7 Rabbit Polyclonal Antibody
E28PT4241 100 µL

SENP7 Rabbit Polyclonal Antibody

Ask
View Details
MED15 Human shRNA Lentiviral Particle (Locus ID 51586)
TL310568V 500 µL Each

MED15 Human shRNA Lentiviral Particle (Locus ID 51586)

Ask
View Details
C8ORF76 (Uncharacterized Protein C8orf76)
476874 100 µL

C8ORF76 (Uncharacterized Protein C8orf76)

Ask
View Details