Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Sorbitol Dehydrogenase/SORD (C-6His)

Source: Human Cells. MW :39.3kD. Recombinant Human Sorbitol Dehydrogenase is produced by our Mammalian expression system and the target gene encoding Ala2-Pro357 is expressed with a 6His tag at the C-terminus. Sorbitol dehydrogenase, also known as L-iditol 2-dehydrogenase and SORD, is a member of the zinc-containing alcohol dehydrogenase family. SORD exsits in a homotetramer and binds one zinc ion per subunit. SORD is expressed in kidney and epithelial cells of both benign and malignant prostate tissue. SORD can converts sorbitol to fructose and catalyzes the interconversion of polyols and their corresponding ketoses, and together with aldose reductase to make up the sorbitol pathway. SORD is up-regulated by androgens and down-regulated by castration. SORD may play a role in the sperm motility by providing an energetic source for sperm.

Product Specifications

Gene Name

SORD

Gene ID

6652

UniProt

Q00796

Components

Supplied as a 0.2 μm filtered solution of 20mM TrisHCl,0.2M NaCl,5mM DTT,20% glycerol, pH8.0.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

AAAAKPNNLSLVVHGPGDLRLENYPIPEPGPNEVLLRMHSVGICGSDVHYWEYGRIGNFIVKKPMVLGHEASGTVEKVGSSVKHLKPGDRVAIEPGAPRENDEFCKMGRYNLSPSIFFCATPPDDGNLCRFYKHNAAFCYKLPDNVTFEEGALIEPLSVGIHACRRGGVTLGHKVLVCGAGPIGMVTLLVAKAMGAAQVVVTDLSATRLSKAKEIGADLVLQISKESPQEIARKVEGQLGCKPEVTIECTGAEASIQAGIYATRSGGTLVLVGLGSEMTTVPLLHAAIREVDIKGVFRYCNTWPVAISMLASKSVNVKPLVTHRFPLEKALEAFETFKKGLGLKIMLKCDPSDQNPVDHHHHHH
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Magic™ Membrane Protein Human EFNB2 (Ephrin B2) Expressed in vitro E.coli expression system, Full Length of Mature Protein
MPX3816K Each

Magic™ Membrane Protein Human EFNB2 (Ephrin B2) Expressed in vitro E.coli expression system, Full Length of Mature Protein

Ask
View Details
Cytokeratin, Basic (Type II or HMW) (PE)
168757-AF-PE 100 µL

Cytokeratin, Basic (Type II or HMW) (PE)

Ask
View Details
Rat Monoclonal Axl Antibody (175128) [FITC]
FAB8541F 0.1 mL

Rat Monoclonal Axl Antibody (175128) [FITC]

Ask
View Details
4-Mercaptobenzoic Acid, Technical Grade
TRC-M252500-1G 1 g

4-Mercaptobenzoic Acid, Technical Grade

Ask
View Details
Rabbit anti-Saccharomyces cerevisiae (strain 204508/S288c)(Baker's yeast) AIM26 Polyclonal Antibody
MBS7157099 Inquire

Rabbit anti-Saccharomyces cerevisiae (strain 204508/S288c)(Baker's yeast) AIM26 Polyclonal Antibody

Ask
View Details