Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Trefoil Factor 2/TFF2 (C-6His)

Source: Human Cells. MW :13kD. Recombinant Human Trefoil Factor 2 is produced by our Mammalian expression system and the target gene encoding Gln24-Tyr129 is expressed with a 6His tag at the C-terminus. Trefoil Factor 2 (TFF2) is a member of the trefoil family and contains two P-type (trefoil) domains. Members of this family are characterized by having at least one copy of the trefoil motif, a 40-amino acid domain that contains three conserved disulfides. TFF2 is a secreted protein and specifically expressed in the stomach. TFF2 inhibits gastrointestinal motility and gastric acid secretion. TFF2 could function as a structural component of gastric mucus, possibly by stabilizing glycoproteins in the mucus gel through interactions with carbohydrate side chains.

Product Specifications

Gene Name

TFF2

Gene ID

7032

UniProt

Q03403

Components

Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl, pH7.2.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

EKPSPCQCSRLSPHNRTNCGFPGITSDQCFDNGCCFDSSVTGVPWCFHPLPKQESDQCVMEVSDRRNCGYPGISPEECASRKCCFSNFIFEVPWCFFPKSVEDCHYVDHHHHHH

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Mouse Monoclonal pan Cytokeratin Antibody (PK110)
NBP2-50222 0.1 mL

Mouse Monoclonal pan Cytokeratin Antibody (PK110)

Ask
View Details
Anti-Rab5 Rabbit pAb
GB111104-50 50 μL

Anti-Rab5 Rabbit pAb

Ask
View Details
KIT, ID (Y730) (KIT, SCFR, Mast/stem cell growth factor receptor Kit, Piebald trait protein, Proto-oncogene c-Kit, Tyrosine-protein kinase Kit, p145 c-kit, v-kit Hardy-Zuckerman 4 feline sarcoma viral oncogene homolog, CD117) (PE) discontinued
037493-PE 200 µL

KIT, ID (Y730) (KIT, SCFR, Mast/stem cell growth factor receptor Kit, Piebald trait protein, Proto-oncogene c-Kit, Tyrosine-protein kinase Kit, p145 c-kit, v-kit Hardy-Zuckerman 4 feline sarcoma viral oncogene homolog, CD117) (PE) discontinued

Ask
View Details
Bicarbamic Acid Diisopropyl Ester
TRC-B382150-250MG 250 mg

Bicarbamic Acid Diisopropyl Ester

Ask
View Details
LPCAT1 Peptide - C-terminal region
MBS3244394-01 0.1 mg

LPCAT1 Peptide - C-terminal region

Ask
View Details
LPCAT1 Peptide - C-terminal region
MBS3244394-02 5x 0.1 mg

LPCAT1 Peptide - C-terminal region

Ask
View Details