Recombinant Human Trefoil Factor 2/TFF2 (C-6His)
Source: Human Cells. MW :13kD. Recombinant Human Trefoil Factor 2 is produced by our Mammalian expression system and the target gene encoding Gln24-Tyr129 is expressed with a 6His tag at the C-terminus. Trefoil Factor 2 (TFF2) is a member of the trefoil family and contains two P-type (trefoil) domains. Members of this family are characterized by having at least one copy of the trefoil motif, a 40-amino acid domain that contains three conserved disulfides. TFF2 is a secreted protein and specifically expressed in the stomach. TFF2 inhibits gastrointestinal motility and gastric acid secretion. TFF2 could function as a structural component of gastric mucus, possibly by stabilizing glycoproteins in the mucus gel through interactions with carbohydrate side chains.
Product Specifications
Gene Name
TFF2
Gene ID
7032
UniProt
Q03403
Components
Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl, pH7.2.
Shipping Conditions
The product is shipped at ambient temperature.
Storage Conditions
Applications Notes
Amino Acids
EKPSPCQCSRLSPHNRTNCGFPGITSDQCFDNGCCFDSSVTGVPWCFHPLPKQESDQCVMEVSDRRNCGYPGISPEECASRKCCFSNFIFEVPWCFFPKSVEDCHYVDHHHHHH
Explore Other Products
Discover premium biology products from our extensive collection of 20M+ items