Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human GMP Reductase 1/GMPR (C-6His)

Source: Human Cells. MW :38.5kD. Recombinant Human GMP Reductase 1 is produced by our Mammalian expression system and the target gene encoding Met1-Ser345 is expressed with a 6His tag at the C-terminus. GMP Reductase 1 (GMPR) is a member of the IMPDH/GMPR family. GMPR exists as a homotetramer and catalyzes the irreversible NADPH-dependent deamination of GMP to IMP. It functions in the conversion of nucleobase, nucleoside and nucleotide derivatives of G to A nucleotides, and in maintaining the intracellular balance of A and G nucleotides. GMP reductase gene expression may be regulated by MITF. At least two different alleles are known.

Product Specifications

Gene Name

GMPR

Gene ID

2766

UniProt

P36959

Components

Supplied as a 0.2 μm filtered solution of 20mM Tris-HCl,40% glycerol,0.15M NaCl and 1mM DTT, pH8.0.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MPRIDADLKLDFKDVLLRPKRSSLKSRAEVDLERTFTFRNSKQTYSGIPIIVANMDTVGTFEMAAVMSQHSMFTAIHKHYSLDDWKLFATNHPECLQNVAVSSGSGQNDLEKMTSILEAVPQVKFICLDVANGYSEHFVEFVKLVRAKFPEHTIMAGNVVTGEMVEELILSGADIIKVGVGPGSVCTTRTKTGVGYPQLSAVIECADSAHGLKGHIISDGGCTCPGDVAKAFGAGADFVMLGGMFSGHTECAGEVFERNGRKLKLFYGMSSDTAMNKHAGGVAEYRASEGKTVEVPYKGDVENTILDILGGLRSTCTYVGAAKLKELSRRATFIRVTQQHNTVFSVDHHHHHH
More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-FAM26F Antibody
MBS8323680-01 0.03 mL

Anti-FAM26F Antibody

Sign In for Pricing
View Details
Anti-FAM26F Antibody
MBS8323680-02 0.05 mL

Anti-FAM26F Antibody

Sign In for Pricing
View Details
Anti-FAM26F Antibody
MBS8323680-03 0.1 mL

Anti-FAM26F Antibody

Sign In for Pricing
View Details
Anti-FAM26F Antibody
MBS8323680-04 0.2 mL

Anti-FAM26F Antibody

Sign In for Pricing
View Details
Anti-FAM26F Antibody
MBS8323680-05 5x 0.2 mL

Anti-FAM26F Antibody

Sign In for Pricing
View Details
Lentiviral human WFDC6 sgRNA gene knockout kit - Lentiviral human WFDC6 sgRNA gene knockout kit (25)
GTR15373920 1 Vial

Lentiviral human WFDC6 sgRNA gene knockout kit - Lentiviral human WFDC6 sgRNA gene knockout kit (25)

Sign In for Pricing
View Details