Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human GMP Reductase 1/GMPR (C-6His)

Source: Human Cells. MW :38.5kD. Recombinant Human GMP Reductase 1 is produced by our Mammalian expression system and the target gene encoding Met1-Ser345 is expressed with a 6His tag at the C-terminus. GMP Reductase 1 (GMPR) is a member of the IMPDH/GMPR family. GMPR exists as a homotetramer and catalyzes the irreversible NADPH-dependent deamination of GMP to IMP. It functions in the conversion of nucleobase, nucleoside and nucleotide derivatives of G to A nucleotides, and in maintaining the intracellular balance of A and G nucleotides. GMP reductase gene expression may be regulated by MITF. At least two different alleles are known.

Product Specifications

Gene Name

GMPR

Gene ID

2766

UniProt

P36959

Components

Supplied as a 0.2 μm filtered solution of 20mM Tris-HCl,40% glycerol,0.15M NaCl and 1mM DTT, pH8.0.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MPRIDADLKLDFKDVLLRPKRSSLKSRAEVDLERTFTFRNSKQTYSGIPIIVANMDTVGTFEMAAVMSQHSMFTAIHKHYSLDDWKLFATNHPECLQNVAVSSGSGQNDLEKMTSILEAVPQVKFICLDVANGYSEHFVEFVKLVRAKFPEHTIMAGNVVTGEMVEELILSGADIIKVGVGPGSVCTTRTKTGVGYPQLSAVIECADSAHGLKGHIISDGGCTCPGDVAKAFGAGADFVMLGGMFSGHTECAGEVFERNGRKLKLFYGMSSDTAMNKHAGGVAEYRASEGKTVEVPYKGDVENTILDILGGLRSTCTYVGAAKLKELSRRATFIRVTQQHNTVFSVDHHHHHH
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

C17orf80 (NM_017941) Human Tagged ORF Clone Lentiviral Particle
RC200157L3V 200 µL

C17orf80 (NM_017941) Human Tagged ORF Clone Lentiviral Particle

Ask
View Details
NDUFB11 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI5B4]
TA807596BM 100 µL

NDUFB11 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI5B4]

Ask
View Details
Cy3 Linked Polyclonal Antibody to Matrix Metalloproteinase 7 (MMP7)
MBS2128390-01 0.1 mL

Cy3 Linked Polyclonal Antibody to Matrix Metalloproteinase 7 (MMP7)

Ask
View Details
Cy3 Linked Polyclonal Antibody to Matrix Metalloproteinase 7 (MMP7)
MBS2128390-02 0.2 mL

Cy3 Linked Polyclonal Antibody to Matrix Metalloproteinase 7 (MMP7)

Ask
View Details
Cy3 Linked Polyclonal Antibody to Matrix Metalloproteinase 7 (MMP7)
MBS2128390-03 0.5 mL

Cy3 Linked Polyclonal Antibody to Matrix Metalloproteinase 7 (MMP7)

Ask
View Details
Cy3 Linked Polyclonal Antibody to Matrix Metalloproteinase 7 (MMP7)
MBS2128390-04 1 mL

Cy3 Linked Polyclonal Antibody to Matrix Metalloproteinase 7 (MMP7)

Ask
View Details