Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Dihydropteridine Reductase/QDPR (C-6His)

Source: Human Cells. MW :26.8kD. Recombinant Human Dihydropteridine Reductase is produced by our Mammalian expression system and the target gene encoding Ala2-Phe244 is expressed with a 6His tag at the C-terminus. Dihydropteridine reductase, also known as HDHPR and Quinoid dihydropteridine reductase, QDPR and DHPR, belongs to the short-chain dehydrogenases/reductases (SDR) family. QDPR exists as a homodimer. QDPR is part of the pathway that recycles a substance called tetrahydrobiopterin, also known as BH4 and tryptophan hydroxylases. The regeneration of this substance is critical for the proper processing of several other amino acids in the body. Tetrahydrobiopterin also helps produce certain chemicals in the brain called neurotransmitters, which transmit signals between nerve cells. Defects in QDPR are the cause of BH4-deficient hyperphenylalaninemia type C (HPABH4C) which is a rare autosomal recessive disorder and is lethal.

Product Specifications

Gene Name

QDPR

Gene ID

5860

UniProt

P09417

Components

Lyophilized from a 0.2 μm filtered solution of 20mM TrisHCl, pH8.0.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

AAAAAAGEARRVLVYGGRGALGSRCVQAFRARNWWVASVDVVENEEASASIIVKMTDSFTEQADQVTAEVGKLLGEEKVDAILCVAGGWAGGNAKSKSLFKNCDLMWKQSIWTSTISSHLATKHLKEGGLLTLAGAKAALDGTPGMIGYGMAKGAVHQLCQSLAGKNSGMPPGAAAIAVLPVTLDTPMNRKSMPEADFSSWTPLEFLVETFHDWITGKNRPSSGSLIQVVTTEGRTELTPAYFVDHHHHHH
More Discoveries

Explore Other Products

Browse additional items from our catalog

Elasine
MF-0025590-01 1 mg

Elasine

Sign In for Pricing
View Details
Elasine
MF-0025590-02 5 mg

Elasine

Sign In for Pricing
View Details
Mouse Probable E3 ubiquitin-protein ligase RNF144A, RNF144A ELISA Kit
MBS9339926-01 48 Well

Mouse Probable E3 ubiquitin-protein ligase RNF144A, RNF144A ELISA Kit

Sign In for Pricing
View Details
Mouse Probable E3 ubiquitin-protein ligase RNF144A, RNF144A ELISA Kit
MBS9339926-02 96 Well

Mouse Probable E3 ubiquitin-protein ligase RNF144A, RNF144A ELISA Kit

Sign In for Pricing
View Details
Mouse Probable E3 ubiquitin-protein ligase RNF144A, RNF144A ELISA Kit
MBS9339926-03 5x 96 Well

Mouse Probable E3 ubiquitin-protein ligase RNF144A, RNF144A ELISA Kit

Sign In for Pricing
View Details
Mouse Probable E3 ubiquitin-protein ligase RNF144A, RNF144A ELISA Kit
MBS9339926-04 10x 96 Well

Mouse Probable E3 ubiquitin-protein ligase RNF144A, RNF144A ELISA Kit

Sign In for Pricing
View Details