Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human 15-PGDH/HPGD (C-6His)

Source: Human Cells. MW :30kD. Recombinant Human HPGD is produced by our Mammalian expression system and the target gene encoding Met1-Gln266 is expressed with a 6His tag at the C-terminus. 15-hydroxyprostaglandin dehydrogenase [NAD (+) ], also known as Prostaglandin dehydrogenase 1, 15-PGDH, HPGD and PGDH1, belongs to the short-chain dehydrogenases/reductases (SDR) family. HPGD localizes to the cytoplasm and can be found in colon epithelium, existing as a homodimer. HPGD catalyzes the NAD-dependent dehydrogenation of lipoxin A4 to form 15-oxo-lipoxin A4. HPGD is down-regulated by cortisol, dexamethasone and betamethasone, up-regulated by TGFB1. HPGD inhibits in vivo proliferation of colon cancer cells. HPGD is the key enzyme for the inactivation of prostaglandins, and thus regulates processes such as inflammation or proliferation.

Product Specifications

Gene Name

HPGD

Gene ID

3248

UniProt

P15428

Components

Supplied as a 0.2 μm filtered solution of 20mM HEPES,150mM NaCl, pH7.4.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MHVNGKVALVTGAAQGIGRAFAEALLLKGAKVALVDWNLEAGVQCKAALDEQFEPQKTLFIQCDVADQQQLRDTFRKVVDHFGRLDILVNNAGVNNEKNWEKTLQINLVSVISGTYLGLDYMSKQNGGEGGIIINMSSLAGLMPVAQQPVYCASKHGIVGFTRSAALAANLMNSGVRLNAICPGFVNTAILESIEKEENMGQYIEYKDHIKDMIKYYGILDPPLIANGLITLIEDDALNGAIMKITTSKGIHFQDYDTTPFQAKTQVDHHHHHH
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

WASP (phospho Tyr290) Rabbit Polyclonal Antibody
E28PP0679 100 µL

WASP (phospho Tyr290) Rabbit Polyclonal Antibody

Ask
View Details
Anti-Nop30 Antibody
24514 100 µL

Anti-Nop30 Antibody

Ask
View Details
Anti-ASIC1 Antibody
11573-1 100 µg

Anti-ASIC1 Antibody

Ask
View Details