Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human 15-PGDH/HPGD (C-6His)

Source: Human Cells. MW :30kD. Recombinant Human HPGD is produced by our Mammalian expression system and the target gene encoding Met1-Gln266 is expressed with a 6His tag at the C-terminus. 15-hydroxyprostaglandin dehydrogenase [NAD (+) ], also known as Prostaglandin dehydrogenase 1, 15-PGDH, HPGD and PGDH1, belongs to the short-chain dehydrogenases/reductases (SDR) family. HPGD localizes to the cytoplasm and can be found in colon epithelium, existing as a homodimer. HPGD catalyzes the NAD-dependent dehydrogenation of lipoxin A4 to form 15-oxo-lipoxin A4. HPGD is down-regulated by cortisol, dexamethasone and betamethasone, up-regulated by TGFB1. HPGD inhibits in vivo proliferation of colon cancer cells. HPGD is the key enzyme for the inactivation of prostaglandins, and thus regulates processes such as inflammation or proliferation.

Product Specifications

Gene Name

HPGD

Gene ID

3248

UniProt

P15428

Components

Supplied as a 0.2 μm filtered solution of 20mM HEPES,150mM NaCl, pH7.4.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MHVNGKVALVTGAAQGIGRAFAEALLLKGAKVALVDWNLEAGVQCKAALDEQFEPQKTLFIQCDVADQQQLRDTFRKVVDHFGRLDILVNNAGVNNEKNWEKTLQINLVSVISGTYLGLDYMSKQNGGEGGIIINMSSLAGLMPVAQQPVYCASKHGIVGFTRSAALAANLMNSGVRLNAICPGFVNTAILESIEKEENMGQYIEYKDHIKDMIKYYGILDPPLIANGLITLIEDDALNGAIMKITTSKGIHFQDYDTTPFQAKTQVDHHHHHH
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Lentiviral mouse Cluap1 shRNA (UAS) - Lentiviral mouse Cluap1 shRNA (UAS, iRFP) (100)
GTR15173919 1 Vial

Lentiviral mouse Cluap1 shRNA (UAS) - Lentiviral mouse Cluap1 shRNA (UAS, iRFP) (100)

Ask
View Details
Ptgdr (NM_008962) Mouse Tagged Lenti ORF Clone
MR225464L3 10 µg

Ptgdr (NM_008962) Mouse Tagged Lenti ORF Clone

Ask
View Details
Phospho-NuMA (Ser1225) Blocking Peptide
MBS9618471-01 1 mg

Phospho-NuMA (Ser1225) Blocking Peptide

Ask
View Details
Phospho-NuMA (Ser1225) Blocking Peptide
MBS9618471-02 5x 1 mg

Phospho-NuMA (Ser1225) Blocking Peptide

Ask
View Details
AKT1/2 Recombinant Antibody, AbBy Fluor™ 488 Conjugated
bsm-63323R-BF488 100 µL

AKT1/2 Recombinant Antibody, AbBy Fluor™ 488 Conjugated

Ask
View Details