Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human VIP36/LMAN2/GP36b (C-6His)

Source: Human Cells. MW :32.7kD. Recombinant Human Vesicular Integral-Membrane Protein VIP36 is produced by our Mammalian expression system and the target gene encoding Asp45-Arg322 is expressed with a 6His tag at the C-terminus. Vesicular integral-membrane protein VIP36 is also known as Glycoprotein GP36b, Lectin mannose-binding 2, Vesicular integral-membrane protein 36, LMAN2 and C5orf8. LMAN2 is widely expressed and contains one L-type lectin-like domain. LMAN2 binds high mannose type glycoproteins and may facilitate their sorting, trafficking and quality control. LMAN2 plays a role as an intracellular lectin in the early secretory pathway. LMAN2 interacts with N-acetyl-D-galactosamine and high-mannose type glycans and may also bind to O-linked glycans. LMAN2 is also involved in the transport and sorting of glycoproteins carrying high mannose-type glycans.

Product Specifications

Gene Name

LMAN2

Gene ID

10960

UniProt

Q12907

Components

Lyophilized from a 0.2 μm filtered solution of 50mM TrisHCl,10mM GSH, pH8.0.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

DITDGNSEHLKREHSLIKPYQGVGSSSMPLWDFQGSTMLTSQYVRLTPDERSKEGSIWNHQPCFLKDWEMHVHFKVHGTGKKNLHGDGIALWYTRDRLVPGPVFGSKDNFHGLAIFLDTYPNDETTERVFPYISVMVNNGSLSYDHSKDGRWTELAGCTADFRNRDHDTFLAVRYSRGRLTVMTDLEDKNEWKNCIDITGVRLPTGYYFGASAGTGDLSDNHDIISMKLFQLMVEHTPDEESIDWTKIEPSVNFLKSPKDNVDDPTGNFRSGPLTGWRVDHHHHHH
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

NFkB-p100, phosphorylated (S865) discontinued
340578-01 100 µL

NFkB-p100, phosphorylated (S865) discontinued

Ask
View Details
NFkB-p100, phosphorylated (S865) discontinued
340578-02 200 µL

NFkB-p100, phosphorylated (S865) discontinued

Ask
View Details
Trim27 (NM_001134974) Rat Untagged Clone
RN200135 10 µg

Trim27 (NM_001134974) Rat Untagged Clone

Ask
View Details
Rabbit anti-Arabidopsis thaliana (Mouse-ear cress) WRKY15 Polyclonal Antibody
MBS7180282 Inquire

Rabbit anti-Arabidopsis thaliana (Mouse-ear cress) WRKY15 Polyclonal Antibody

Ask
View Details
Rabbit Polyclonal ATG12 Antibody [HRP]
NBP1-76860H 0.1 mL

Rabbit Polyclonal ATG12 Antibody [HRP]

Ask
View Details