Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Dipeptidyl-Peptidase 1/DPP1 (C-6His)

Source: Human Cells. MW :42.1kD. Recombinant Human Dipeptidase 1 is produced by our Mammalian expression system and the target gene encoding Asp17-Ser385 is expressed with a 6His tag at the C-terminus. Dipeptidase 1 (DPEP1) is a kidney membrane enzyme that belongs to the peptidase M19 family. DPEP1 is a homodimer and is inhibited by L-penicillamine. DPEP1 hydrolyzes a variety of dipeptides and is implicated in renal metabolism of glutathione and its conjugates. DPEP1 is responsible for hydrolysis of the beta-lactam ring of antibiotics, such as penem and carbapenem. DPEP1 may play an important role in the regulation of leukotriene activity. DPEP1 expression in cancer is significantly higher than that in normal tissue. However, DPEP1 expression decreased with pathological differentiation, lymph-node and distant metastasis.

Product Specifications

Gene Name

DPEP1

Gene ID

1800

UniProt

P16444

Components

Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl, pH7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

DFFRDEAERIMRDSPVIDGHNDLPWQLLDMFNNRLQDERANLTTLAGTHTNIPKLRAGFVGGQFWSVYTPCDTQNKDAVRRTLEQMDVVHRMCRMYPETFLYVTSSAGIRQAFREGKVASLIGVEGGHSIDSSLGVLRALYQLGMRYLTLTHSCNTPWADNWLVDTGDSEPQSQGLSPFGQRVVKELNRLGVLIDLAHVSVATMKATLQLSRAPVIFSHSSAYSVCASRRNVPDDVLRLVKQTDSLVMVNFYNNYISCTNKANLSQVADHLDHIKEVAGARAVGFGGDFDGVPRVPEGLEDVSKYPDLIAELLRRNWTEAEVKGALADNLLRVFEAVEQASNLTQAPEEEPIPLDQLGGSCRTHYGYSSVDHHHHHH
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Human SLMO1 knockout cell line
ABC-KH14246 1 Vial

Human SLMO1 knockout cell line

Ask
View Details
Olfr1230 Mouse shRNA Lentiviral Particle (Locus ID 258785)
TL509457V 500 µL Each

Olfr1230 Mouse shRNA Lentiviral Particle (Locus ID 258785)

Ask
View Details
Defensin α3 Polyclonal Antibody
ABP53990-01 30 µL

Defensin α3 Polyclonal Antibody

Ask
View Details
Defensin α3 Polyclonal Antibody
ABP53990-02 100 µL

Defensin α3 Polyclonal Antibody

Ask
View Details
Defensin α3 Polyclonal Antibody
ABP53990-03 200 µL

Defensin α3 Polyclonal Antibody

Ask
View Details
Carbonyl dihydrido tris (triphenylphosphine) ruthenium (II) ; 99.95% (metals basis)
GX3600-1g 1 g

Carbonyl dihydrido tris (triphenylphosphine) ruthenium (II) ; 99.95% (metals basis)

Ask
View Details