Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Triggering Receptor Expressed On Myeloid 2/TREM-2 (C-6His)

Source: Human Cells. MW :18.3kD. Recombinant Human Triggering Receptor Expressed On Myeloid Cells 2 is produced by our Mammalian expression system and the target gene encoding His19-Ser174 is expressed with a 6His tag at the C-terminus. Triggering Receptor Expressed on Myeloid cells 2 (TREM2) is a 35 kDa type I transmembrane member of the TREM family and Ig superfamily. Mature human TREM2 consists of a 156 amino acid (aa) extracellular domain (ECD) with one V-type Ig-like domain, a 21 aa transmembrane (TM) domain, and a 35 aa cytoplasmic tail. Soluble forms of the TREM2 ECD are generated by alternative splicing or proteolytic cleavage, and the cytoplasmic domain can be liberated by gamma-Secretase mediated intramembrane cleavage. A positively charged lysine within the transmembrane segment allows association with the signal adapter protein, DAP12 and inhibition of macrophage activation. TREM2 is expressed on macrophages, immature myeloid dendritic cells, osteoclasts, microglia, and adipocytes.It promotes the differentiation and function of osteoclasts, the production of inflammatory cytokines by adipocytes, insulin resistance, and the phagocytic clearance of bacteria.

Product Specifications

Gene Name

TREM2

Gene ID

54209

UniProt

Q9NZC2

Components

Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

HNTTVFQGVAGQSLQVSCPYDSMKHWGRRKAWCRQLGEKGPCQRVVSTHNLWLLSFLRRWNGSTAITDDTLGGTLTITLRNLQPHDAGLYQCQSLHGSEADTLRKVLVEVLADPLDHRDAGDLWFPGESESFEDAHVEHSISRSLLEGEIPFPPTSHHHHHH
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Armenian Hamster monoclonal CD61 antibody (PE)
MBS5305611-01 0.05 mg

Armenian Hamster monoclonal CD61 antibody (PE)

Ask
View Details
Armenian Hamster monoclonal CD61 antibody (PE)
MBS5305611-02 0.1 mg

Armenian Hamster monoclonal CD61 antibody (PE)

Ask
View Details
Armenian Hamster monoclonal CD61 antibody (PE)
MBS5305611-03 5x 0.1 mg

Armenian Hamster monoclonal CD61 antibody (PE)

Ask
View Details
FGF23 Antibody
MBS9413236-01 0.05 mL

FGF23 Antibody

Ask
View Details
FGF23 Antibody
MBS9413236-02 0.1 mL

FGF23 Antibody

Ask
View Details
FGF23 Antibody
MBS9413236-03 5x 0.1 mL

FGF23 Antibody

Ask
View Details