Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Ribose-Phosphate Pyrophosphokinase 2/PRPS2 (C-6His)

Source: Human Cells. MW :35.8kD. Recombinant Human PRPS2 is produced by our Mammalian expression system and the target gene encoding Pro2-Leu318 is expressed with a 6His tag at the C-terminus. Ribose-Phosphate Pyrophosphokinase 2 (PRPS2) is a phosphoribosyl pyrophosphate synthetase that belongs to the ribose-phosphate pyrophosphokinase family. PRPS2 is a homodimer. The active form is probably an hexamer composed of three homodimers. PRPS2 catalyzes the synthesis of phosphoribosylpyrophosphate (PRPP) that is essential for nucleotide synthesis. PRPS2 catalyzes the synthesis of 5-phosphoribosyl 1-pyrophosphate from ATP and D-ribose 5-phosphate. In addition, PRPS2 plays a central role in the synthesis of purines and pyrimidines.

Product Specifications

Gene Name

PRPS2

Gene ID

5634

UniProt

P11908

Components

Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl, pH7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

PNIVLFSGSSHQDLSQRVADRLGLELGKVVTKKFSNQETSVEIGESVRGEDVYIIQSGCGEINDNLMELLIMINACKIASSSRVTAVIPCFPYARQDKKDKSRAPISAKLVANMLSVAGADHIITMDLHASQIQGFFDIPVDNLYAEPAVLQWIRENIAEWKNCIIVSPDAGGAKRVTSIADRLNVEFALIHKERKKANEVDRMVLVGDVKDRVAILVDDMADTCGTICHAADKLLSAGATKVYAILTHGIFSGPAISRINNAAFEAVVVTNTIPQEDKMKHCTKIQVIDISMILAEAIRRTHNGESVSYLFSHVPLVDHHHHHH
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Lentiviral human TDRD5 shRNA (UAS) - Lentiviral human TDRD5 shRNA (UAS) (25)
GTR15345872 1 Vial

Lentiviral human TDRD5 shRNA (UAS) - Lentiviral human TDRD5 shRNA (UAS) (25)

Ask
View Details
TRAF6 (NM_004620) Human Tagged ORF Clone
RG219528 10 µg

TRAF6 (NM_004620) Human Tagged ORF Clone

Ask
View Details
1X PBS with Ca, Mg
IBS-CB022 1 L

1X PBS with Ca, Mg

Ask
View Details
PRDM5 CRISPRa sgRNA lentivector (set of three targets)(Mouse)
37576124 3x 1.0µg DNA

PRDM5 CRISPRa sgRNA lentivector (set of three targets)(Mouse)

Ask
View Details
Monkey Aquaporin-6 (AQP6) ELISA Kit
MBS7262417-01 48 Well

Monkey Aquaporin-6 (AQP6) ELISA Kit

Ask
View Details
Monkey Aquaporin-6 (AQP6) ELISA Kit
MBS7262417-02 96 Well

Monkey Aquaporin-6 (AQP6) ELISA Kit

Ask
View Details