Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Galectin-14/LGALS14 (C-6His)

Source: Human Cells. MW :17.1kD. Recombinant Human Galectin-14 is produced by our Mammalian expression system and the target gene encoding Met1-Asp139 is expressed with a 6His tag at the C-terminus. Galectin-14 is a member of the Galectin family of carbohydrate binding proteins. The members of Galectin family contain one or two carbohydrate recognition domains, which can bind beta-Galactoside. LGALS14 is expressed intracellularly in placenta and eosinophils, and is released by eosinophils following allergen stimulation. LGALS14 may be involved in the development of allergic inflammation. Two alternatively spliced transcript variants encoding distinct isoforms have been observed.

Product Specifications

Gene Name

LGALS14

Gene ID

56891

UniProt

Q8TCE9

Components

Supplied as a 0.2 μm filtered solution of 20mM Tri,100mM NaCl,1mM DTT,20% glycerol, pH8.0.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MSSLPVPYTLPVSLPVGSCVIITGTPILTFVKDPQLEVNFYTGMDEDSDIAFQFRLHFGHPAIMNSRVFGIWRYEEKCYYLPFEDGKPFELCIYVRHKEYKVMVNGQRIYNFAHRFPPASVKMLQVLRDISLTRVLISDVDHHHHHH

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Mouse Monoclonal S100A9 Antibody (47-8D3)
NBP2-44914-0.02mg 0.02 mg

Mouse Monoclonal S100A9 Antibody (47-8D3)

Ask
View Details
Rabbit Polyclonal P-Cadherin Antibody
NBP1-59222 100 µL

Rabbit Polyclonal P-Cadherin Antibody

Ask
View Details
Human Olfactory receptor 4B1 (OR4B1) ELISA Kit
abx537011 96 Tests

Human Olfactory receptor 4B1 (OR4B1) ELISA Kit

Ask
View Details
Recombinant Myxine glutinosa Calmodulin
MBS1482342-01 0.02 mg (E-Coli)

Recombinant Myxine glutinosa Calmodulin

Ask
View Details
Recombinant Myxine glutinosa Calmodulin
MBS1482342-02 0.1 mg (E-Coli)

Recombinant Myxine glutinosa Calmodulin

Ask
View Details
Recombinant Myxine glutinosa Calmodulin
MBS1482342-03 0.02 mg (Yeast)

Recombinant Myxine glutinosa Calmodulin

Ask
View Details