Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Myelin Protein P0/MPZ (C-6His)

Source: Human Cells. MW :15.2kD. Recombinant Human Myelin Protein P0 is produced by our Mammalian expression system and the target gene encoding Ile30-Arg153 is expressed with a 6His tag at the C-terminus. Myelin Protein P0 (MPZ) is a single-pass type I membrane glycoprotein which belongs to the myelin P0 protein family. MPZ contains one Ig-like V-type (immunoglobulin-like) domain, absent in the central nervous system. MPZ is a major component of the myelin sheath in peripheral nerves. It is postulated that MPZ is a structural element in the formation and stabilisation of peripheral nerve myelin, holding its characteristic coil structure together by the interaction of its positively-charged domain with acidic lipids in the cytoplasmic face of the opposed bilayer, and by interaction between hydrophobic globular of adjacent extracellular domains. Defects in MPZ associated with Charcot-Marie-Tooth disease and Dejerine-Sottas disease.

Product Specifications

Gene Name

MPZ

Gene ID

4359

UniProt

P25189

Components

Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl, pH7.2.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

IVVYTDREVHGAVGSRVTLHCSFWSSEWVSDDISFTWRYQPEGGRDAISIFHYAKGQPYIDEVGTFKERIQWVGDPRWKDGSIVIHNLDYSDNGTFTCDVKNPPDIVGKTSQVTLYVFEKVPTRVDHHHHHH

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

TTF1 Monoclonal Antibody
MBS2579991-01 0.1 mL

TTF1 Monoclonal Antibody

Ask
View Details
TTF1 Monoclonal Antibody
MBS2579991-02 0.2 mL

TTF1 Monoclonal Antibody

Ask
View Details
TTF1 Monoclonal Antibody
MBS2579991-03 1 mL

TTF1 Monoclonal Antibody

Ask
View Details
TTF1 Monoclonal Antibody
MBS2579991-04 5x 1 mL

TTF1 Monoclonal Antibody

Ask
View Details
TCTN3 ORF Vector (Human) (pORF)
46434011 1.0 µg DNA

TCTN3 ORF Vector (Human) (pORF)

Ask
View Details
AMPK alpha 1 Blocking Peptide
MBS8244169-01 1 mg

AMPK alpha 1 Blocking Peptide

Ask
View Details