Recombinant Human Myelin Protein P0/MPZ (C-6His)
Source: Human Cells. MW :15.2kD. Recombinant Human Myelin Protein P0 is produced by our Mammalian expression system and the target gene encoding Ile30-Arg153 is expressed with a 6His tag at the C-terminus. Myelin Protein P0 (MPZ) is a single-pass type I membrane glycoprotein which belongs to the myelin P0 protein family. MPZ contains one Ig-like V-type (immunoglobulin-like) domain, absent in the central nervous system. MPZ is a major component of the myelin sheath in peripheral nerves. It is postulated that MPZ is a structural element in the formation and stabilisation of peripheral nerve myelin, holding its characteristic coil structure together by the interaction of its positively-charged domain with acidic lipids in the cytoplasmic face of the opposed bilayer, and by interaction between hydrophobic globular of adjacent extracellular domains. Defects in MPZ associated with Charcot-Marie-Tooth disease and Dejerine-Sottas disease.
Product Specifications
Gene Name
MPZ
Gene ID
4359
UniProt
P25189
Components
Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl, pH7.2.
Shipping Conditions
The product is shipped at ambient temperature.
Storage Conditions
Applications Notes
Amino Acids
IVVYTDREVHGAVGSRVTLHCSFWSSEWVSDDISFTWRYQPEGGRDAISIFHYAKGQPYIDEVGTFKERIQWVGDPRWKDGSIVIHNLDYSDNGTFTCDVKNPPDIVGKTSQVTLYVFEKVPTRVDHHHHHH
Explore Other Products
Discover premium biology products from our extensive collection of 20M+ items