Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Growth Dfferentiation Factor 11/GDF-11/BMP-11

Source: Human Cells. MW :12.6kD. Recombinant Human Growth differentiation factor 11 is produced by our Mammalian expression system and the target gene encoding Asn299-Ser407 is expressed. Growth/differentiation factor 11 (GDF-11) is a secreted protein, which belongs to the transforming growth factor beta superfamily. GDF-11 controls anterior-posterior patterning by regulating the expression of Hox genes. The secreted signal acts globally to specify positional identity along the anterior/posterior axis during development. GDF11 has been shown to suppress neurogenesis through a pathway similar to that of myostatin, including stopping the progenitor cell-cycle during G-phase. The similarities between GDF11 and myostatin imply a likelihood that the same regulatory mechanisms are used to control tissue size during both muscular and neural development.

Product Specifications

Gene Name

GDF11

Gene ID

10220

UniProt

O95390

Components

Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

NLGLDCDEHSSESRCCRYPLTVDFEAFGWDWIIAPKRYKANYCSGQCEYMFMQKYPHTHLVQQANPRGSAGPCCTPTKMSPINMLYFNDKQQIIYGKIPGMVVDRCGCS

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

CD122 Antibody
E38PA7092 100 µL

CD122 Antibody

Ask
View Details
Human CCKBR (Gastrin/cholecystokinin type B receptor) ELISA Kit
EH7123 96 Tests

Human CCKBR (Gastrin/cholecystokinin type B receptor) ELISA Kit

Ask
View Details
MRPL36 Over-expression Lysate Product
GWB-9D71C4 0.1 mg

MRPL36 Over-expression Lysate Product

Ask
View Details
Rabbit anti-DLST Antibody, Affinity Purified
A304-309A 100 µg

Rabbit anti-DLST Antibody, Affinity Purified

Ask
View Details