Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human S100 Calcium Binding Protein A8/A9 Heterodimer (C-6His)

Source: E.coli. MW :11.7&13.2kD. Recombinant Human S100A8 & S100A9 Heterodimer is produced by our E.coli expression system and the target gene encoding Met1-Glu93 (S100A8) &Thr2-Pro114 (S100A9) is expressed with a 6His tag at the C-terminus. S100A8 is a member of the S100 family, EF-hand superfamily of Ca-binding proteins. It is produced by neutrophils and monocytes, and forms Ca2+-dependent heterodimer/heterotetramer complexes (termed calprotectin) with S100A9. Calprotectin (S100A8/A9) which has a wide plethora of intra- and extracellular functions. The intracellular functions include: facilitating leukocyte arachidonic acid trafficking and metabolism, modulation of the tubulin-dependent cytoskeleton during migration of phagocytes and activation of the neutrophilic NADPH-oxidase.

Product Specifications

Gene Name

S100A8

Gene ID

6279

UniProt

P05109

Components

Supplied as a 0.2 μm filtered solution of 20mM HEPES,10%Glycerol,150mM NaCl,2.5mM EDTA, pH 7.4.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MLTELEKALNSIIDVYHKYSLIKGNFHAVYRDDLKKLLETECPQYIRKKGADVWFKELDINTDGAVNFQEFLILVIKMGVAAHKKSHEESHKEHHHHHH&TCKMSQLERNIETIINTFHQYSVKLGHPDTLNQGEFKELVRKDLQNFLKKENKNEKVIEHIMEDLDTNADKQLSFEEFIMLMARLTWASHEKMHEGDEGPGHHHKPGLGEGTP
Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

CCT8, CT (CCT8, C21orf112, CCTQ, KIAA0002, T-complex protein 1 subunit theta, CCT-theta, Renal carcinoma antigen NY-REN-15) (MaxLight 490)
MBS6282691-01 0.1 mL

CCT8, CT (CCT8, C21orf112, CCTQ, KIAA0002, T-complex protein 1 subunit theta, CCT-theta, Renal carcinoma antigen NY-REN-15) (MaxLight 490)

Ask
View Details
CCT8, CT (CCT8, C21orf112, CCTQ, KIAA0002, T-complex protein 1 subunit theta, CCT-theta, Renal carcinoma antigen NY-REN-15) (MaxLight 490)
MBS6282691-02 5x 0.1 mL

CCT8, CT (CCT8, C21orf112, CCTQ, KIAA0002, T-complex protein 1 subunit theta, CCT-theta, Renal carcinoma antigen NY-REN-15) (MaxLight 490)

Ask
View Details
Ghcagons-Like peptide 1 (GLP-1) Mouse ELISA Kit
20517 96 Tests

Ghcagons-Like peptide 1 (GLP-1) Mouse ELISA Kit

Ask
View Details
Recombinant Human BRPF1
P5394-01 50 µg

Recombinant Human BRPF1

Ask
View Details
Recombinant Human BRPF1
P5394-02 200 µg

Recombinant Human BRPF1

Ask
View Details
Recombinant Human BRPF1
P5394-03 1 mg

Recombinant Human BRPF1

Ask
View Details