Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human S100 Calcium Binding Protein A8/A9 Heterodimer (C-6His)

Source: E.coli. MW :11.7&13.2kD. Recombinant Human S100A8 & S100A9 Heterodimer is produced by our E.coli expression system and the target gene encoding Met1-Glu93 (S100A8) &Thr2-Pro114 (S100A9) is expressed with a 6His tag at the C-terminus. S100A8 is a member of the S100 family, EF-hand superfamily of Ca-binding proteins. It is produced by neutrophils and monocytes, and forms Ca2+-dependent heterodimer/heterotetramer complexes (termed calprotectin) with S100A9. Calprotectin (S100A8/A9) which has a wide plethora of intra- and extracellular functions. The intracellular functions include: facilitating leukocyte arachidonic acid trafficking and metabolism, modulation of the tubulin-dependent cytoskeleton during migration of phagocytes and activation of the neutrophilic NADPH-oxidase.

Product Specifications

Gene Name

S100A8

Gene ID

6279

UniProt

P05109

Components

Supplied as a 0.2 μm filtered solution of 20mM HEPES,10%Glycerol,150mM NaCl,2.5mM EDTA, pH 7.4.

Shipping Conditions

The product is shipped on dry ice/ice packs.

Storage Conditions

Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.

Applications Notes

Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MLTELEKALNSIIDVYHKYSLIKGNFHAVYRDDLKKLLETECPQYIRKKGADVWFKELDINTDGAVNFQEFLILVIKMGVAAHKKSHEESHKEHHHHHH&TCKMSQLERNIETIINTFHQYSVKLGHPDTLNQGEFKELVRKDLQNFLKKENKNEKVIEHIMEDLDTNADKQLSFEEFIMLMARLTWASHEKMHEGDEGPGHHHKPGLGEGTP
More Discoveries

Explore Other Products

Browse additional items from our catalog

USPL1 sgRNA CRISPR Lentivector (Human) (Target 2)
K2602303 1.0 µg DNA

USPL1 sgRNA CRISPR Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
Bovine Complement component 1 Q subcomponent-binding protein, mitochondrial ELISA Kit
MBS2888118-01 48 Well

Bovine Complement component 1 Q subcomponent-binding protein, mitochondrial ELISA Kit

Sign In for Pricing
View Details
Bovine Complement component 1 Q subcomponent-binding protein, mitochondrial ELISA Kit
MBS2888118-02 96 Well

Bovine Complement component 1 Q subcomponent-binding protein, mitochondrial ELISA Kit

Sign In for Pricing
View Details
Bovine Complement component 1 Q subcomponent-binding protein, mitochondrial ELISA Kit
MBS2888118-03 5x 96 Well

Bovine Complement component 1 Q subcomponent-binding protein, mitochondrial ELISA Kit

Sign In for Pricing
View Details
Bovine Complement component 1 Q subcomponent-binding protein, mitochondrial ELISA Kit
MBS2888118-04 10x 96 Well

Bovine Complement component 1 Q subcomponent-binding protein, mitochondrial ELISA Kit

Sign In for Pricing
View Details
Scg2 ORF Vector (Rat) (pORF)
ORF075871 1.0 µg DNA

Scg2 ORF Vector (Rat) (pORF)

Sign In for Pricing
View Details