Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human S100 Calcium Binding Protein A9/S100A9/MRP14

Source: E.coli. MW :13.2kD. Recombinant Human S100 Calcium Binding Protein A9 is produced by our E.coli expression system and the target gene encoding Thr2-Pro114 is expressed. Protein S100-A9 (also MRP14 and calgranulin B) is a calcium- and zinc-binding protein which plays a prominent role in the regulation of inflammatory processes and immune response.It can induce neutrophil chemotaxis, adhesion, can increase the bactericidal activity of neutrophils by promoting phagocytosis via activation of SYK, PI3K/AKT, and ERK1/2 and can induce degranulation of neutrophils by a MAPK-dependent mechanism.

Product Specifications

Gene Name

S100A9

Gene ID

6280

UniProt

P06702

Components

Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

TCKMSQLERNIETIINTFHQYSVKLGHPDTLNQGEFKELVRKDLQNFLKKENKNEKVIEHIMEDLDTNADKQLSFEEFIMLMARLTWASHEKMHEGDEGPGHHHKPGLGEGTP

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

CARD4, CT (Nucleotide-binding Oligomerization Domain-containing Protein 1, Caspase Recruitment Domain-containing Protein 4, NOD1) (MaxLight 405)
MBS6467168-01 0.1 mL

CARD4, CT (Nucleotide-binding Oligomerization Domain-containing Protein 1, Caspase Recruitment Domain-containing Protein 4, NOD1) (MaxLight 405)

Ask
View Details
CARD4, CT (Nucleotide-binding Oligomerization Domain-containing Protein 1, Caspase Recruitment Domain-containing Protein 4, NOD1) (MaxLight 405)
MBS6467168-02 5x 0.1 mL

CARD4, CT (Nucleotide-binding Oligomerization Domain-containing Protein 1, Caspase Recruitment Domain-containing Protein 4, NOD1) (MaxLight 405)

Ask
View Details
Mouse Monoclonal CXCR2/IL-8 RB Antibody (5E8-C7-F10)
NBP1-43338-0.025mg 0.025 mg

Mouse Monoclonal CXCR2/IL-8 RB Antibody (5E8-C7-F10)

Ask
View Details
Synuclein, alpha, Recombinant, Human
S9500-42 500 µg

Synuclein, alpha, Recombinant, Human

Ask
View Details
TRIM16 Antibody
A42485-100UL 100 µL

TRIM16 Antibody

Ask
View Details