Recombinant Human S100 Calcium Binding Protein A9/S100A9/MRP14
Source: E.coli. MW :13.2kD. Recombinant Human S100 Calcium Binding Protein A9 is produced by our E.coli expression system and the target gene encoding Thr2-Pro114 is expressed. Protein S100-A9 (also MRP14 and calgranulin B) is a calcium- and zinc-binding protein which plays a prominent role in the regulation of inflammatory processes and immune response.It can induce neutrophil chemotaxis, adhesion, can increase the bactericidal activity of neutrophils by promoting phagocytosis via activation of SYK, PI3K/AKT, and ERK1/2 and can induce degranulation of neutrophils by a MAPK-dependent mechanism.
Product Specifications
Gene Name
S100A9
Gene ID
6280
UniProt
P06702
Components
Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.
Shipping Conditions
The product is shipped at ambient temperature.
Storage Conditions
Applications Notes
Amino Acids
TCKMSQLERNIETIINTFHQYSVKLGHPDTLNQGEFKELVRKDLQNFLKKENKNEKVIEHIMEDLDTNADKQLSFEEFIMLMARLTWASHEKMHEGDEGPGHHHKPGLGEGTP
Explore Other Products
Discover premium biology products from our extensive collection of 20M+ items