Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human S100 Calcium Binding Protein A9/S100A9/MRP14

Source: E.coli. MW :13.2kD. Recombinant Human S100 Calcium Binding Protein A9 is produced by our E.coli expression system and the target gene encoding Thr2-Pro114 is expressed. Protein S100-A9 (also MRP14 and calgranulin B) is a calcium- and zinc-binding protein which plays a prominent role in the regulation of inflammatory processes and immune response.It can induce neutrophil chemotaxis, adhesion, can increase the bactericidal activity of neutrophils by promoting phagocytosis via activation of SYK, PI3K/AKT, and ERK1/2 and can induce degranulation of neutrophils by a MAPK-dependent mechanism.

Product Specifications

Gene Name

S100A9

Gene ID

6280

UniProt

P06702

Components

Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

TCKMSQLERNIETIINTFHQYSVKLGHPDTLNQGEFKELVRKDLQNFLKKENKNEKVIEHIMEDLDTNADKQLSFEEFIMLMARLTWASHEKMHEGDEGPGHHHKPGLGEGTP

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Recombinant Human Annexin A11 Protein
NBP1-50857-0.1mg 0.1 mg

Recombinant Human Annexin A11 Protein

Ask
View Details
Rabbit Anti-Human Ras mAb
MA1094-01 50 μL

Rabbit Anti-Human Ras mAb

Ask
View Details
Rabbit Anti-Human Ras mAb
MA1094-02 100 μL

Rabbit Anti-Human Ras mAb

Ask
View Details
QTRTD1 (QTRT2) (NM_024638) Human Over-expression Lysate
LS079691-20ug 20 µg

QTRTD1 (QTRT2) (NM_024638) Human Over-expression Lysate

Ask
View Details
Rabbit Substance P (SP) ELISA Kit
EIA06357Rb 1 Kit

Rabbit Substance P (SP) ELISA Kit

Ask
View Details
ART4, 47-285aa, Human, His-tag, Baculovirus
MBS206781-01 0.01 mg

ART4, 47-285aa, Human, His-tag, Baculovirus

Ask
View Details