Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human S100 Calcium Binding Protein A8/S100A8/Mrp8 (C-6His)

Source: E.coli. MW :11.7kD. Recombinant Human S100 Calcium Binding Protein A8 is produced by our E.coli expression system and the target gene encoding Met1-Glu93 is expressed with a 6His tag at the C-terminus. Protein S100-A8 (also MRP8 and calgranulin A) is a calcium- and zinc-binding protein.It plays a prominent role in the regulation of inflammatory processes and immune response. S100A8 can induce neutrophil chemotaxis and adhesion. Its role as an oxidant scavenger has a protective role in preventing exaggerated tissue damage by scavenging oxidants. It can act as a potent amplifier of inflammation in autoimmunity as well as in cancer development and tumor spread.

Product Specifications

Gene Name

S100A8

Gene ID

6279

UniProt

P05109

Components

Lyophilized from a 0.2 μm filtered solution of 20mM HEPES,150mM NaCl, pH 7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MLTELEKALNSIIDVYHKYSLIKGNFHAVYRDDLKKLLETECPQYIRKKGADVWFKELDINTDGAVNFQEFLILVIKMGVAAHKKSHEESHKEHHHHHH

More Discoveries

Explore Other Products

Browse additional items from our catalog

C. difficile Toxin B Matched Antibody Pair Set [ABP-S-07196]
ABP-S-07196 5 Plates

C. difficile Toxin B Matched Antibody Pair Set [ABP-S-07196]

Sign In for Pricing
View Details
NR3C2 (Mineralocorticoid Receptor, MR, Nuclear Receptor Subfamily 3 Group C Member 2, MCR, MLR, FLJ41052, MGC133092, NR3C2VIT) (MaxLight 405)
MBS6401510-01 0.1 mL

NR3C2 (Mineralocorticoid Receptor, MR, Nuclear Receptor Subfamily 3 Group C Member 2, MCR, MLR, FLJ41052, MGC133092, NR3C2VIT) (MaxLight 405)

Sign In for Pricing
View Details
NR3C2 (Mineralocorticoid Receptor, MR, Nuclear Receptor Subfamily 3 Group C Member 2, MCR, MLR, FLJ41052, MGC133092, NR3C2VIT) (MaxLight 405)
MBS6401510-02 5x 0.1 mL

NR3C2 (Mineralocorticoid Receptor, MR, Nuclear Receptor Subfamily 3 Group C Member 2, MCR, MLR, FLJ41052, MGC133092, NR3C2VIT) (MaxLight 405)

Sign In for Pricing
View Details
Fev Mouse qPCR Primer Pair (NM_153111)
MP204783 200 Reactions

Fev Mouse qPCR Primer Pair (NM_153111)

Sign In for Pricing
View Details
Tissue FFPE Sections, Small intestine
CS711326 5x 5 µm

Tissue FFPE Sections, Small intestine

Sign In for Pricing
View Details
Anti-Mucin 1 antibody
STJ97312 200 µl

Anti-Mucin 1 antibody

Sign In for Pricing
View Details