Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human S100 Calcium Binding Protein A8/S100A8/Mrp8 (C-6His)

Source: E.coli. MW :11.7kD. Recombinant Human S100 Calcium Binding Protein A8 is produced by our E.coli expression system and the target gene encoding Met1-Glu93 is expressed with a 6His tag at the C-terminus. Protein S100-A8 (also MRP8 and calgranulin A) is a calcium- and zinc-binding protein.It plays a prominent role in the regulation of inflammatory processes and immune response. S100A8 can induce neutrophil chemotaxis and adhesion. Its role as an oxidant scavenger has a protective role in preventing exaggerated tissue damage by scavenging oxidants. It can act as a potent amplifier of inflammation in autoimmunity as well as in cancer development and tumor spread.

Product Specifications

Gene Name

S100A8

Gene ID

6279

UniProt

P05109

Components

Lyophilized from a 0.2 μm filtered solution of 20mM HEPES,150mM NaCl, pH 7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MLTELEKALNSIIDVYHKYSLIKGNFHAVYRDDLKKLLETECPQYIRKKGADVWFKELDINTDGAVNFQEFLILVIKMGVAAHKKSHEESHKEHHHHHH

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

DDX12 Rabbit Polyclonal Antibody
MBS9514184-01 0.05 mL

DDX12 Rabbit Polyclonal Antibody

Ask
View Details
DDX12 Rabbit Polyclonal Antibody
MBS9514184-02 0.1 mL

DDX12 Rabbit Polyclonal Antibody

Ask
View Details
DDX12 Rabbit Polyclonal Antibody
MBS9514184-03 5x 0.1 mL

DDX12 Rabbit Polyclonal Antibody

Ask
View Details
ARF1, ID (ARF1, ADP-ribosylation factor 1) (MaxLight 550) discontinued
032018-ML550 100 µL

ARF1, ID (ARF1, ADP-ribosylation factor 1) (MaxLight 550) discontinued

Ask
View Details
Mitf Mouse siRNA Oligo Duplex (Locus ID 17342)
SR426756 1 Kit

Mitf Mouse siRNA Oligo Duplex (Locus ID 17342)

Ask
View Details
UBE2E3 Mouse Monoclonal Antibody [Clone ID: LBI3H2]
AMM14324V 100 µL

UBE2E3 Mouse Monoclonal Antibody [Clone ID: LBI3H2]

Ask
View Details