Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human S100 Calcium Binding Protein A8/S100A8/Mrp8 (C-6His)

Source: E.coli. MW :11.7kD. Recombinant Human S100 Calcium Binding Protein A8 is produced by our E.coli expression system and the target gene encoding Met1-Glu93 is expressed with a 6His tag at the C-terminus. Protein S100-A8 (also MRP8 and calgranulin A) is a calcium- and zinc-binding protein.It plays a prominent role in the regulation of inflammatory processes and immune response. S100A8 can induce neutrophil chemotaxis and adhesion. Its role as an oxidant scavenger has a protective role in preventing exaggerated tissue damage by scavenging oxidants. It can act as a potent amplifier of inflammation in autoimmunity as well as in cancer development and tumor spread.

Product Specifications

Gene Name

S100A8

Gene ID

6279

UniProt

P05109

Components

Lyophilized from a 0.2 μm filtered solution of 20mM HEPES,150mM NaCl, pH 7.4.

Shipping Conditions

The product is shipped at ambient temperature.

Storage Conditions

Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.

Applications Notes

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Endotoxin : Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Amino Acids

MLTELEKALNSIIDVYHKYSLIKGNFHAVYRDDLKKLLETECPQYIRKKGADVWFKELDINTDGAVNFQEFLILVIKMGVAAHKKSHEESHKEHHHHHH

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

PE Conjugated Anti-Human CD270 (Clone: CW10)
30-2813PE-100 100 Tests

PE Conjugated Anti-Human CD270 (Clone: CW10)

Ask
View Details
Inhibin Alpha Monoclonal Antibody
BT-MCA0780-01 50 µL

Inhibin Alpha Monoclonal Antibody

Ask
View Details
Inhibin Alpha Monoclonal Antibody
BT-MCA0780-02 100 µL

Inhibin Alpha Monoclonal Antibody

Ask
View Details
Combretastatin A4 50mg
A12601-50 50 mg

Combretastatin A4 50mg

Ask
View Details
Lcorl (NM_178142) Mouse Tagged ORF Clone
MR222065 10 µg

Lcorl (NM_178142) Mouse Tagged ORF Clone

Ask
View Details
Recombinant Acidothermus cellulolyticus NADH-quinone oxidoreductase subunit B (nuoB)
MBS1252896-01 0.02 mg (E-Coli)

Recombinant Acidothermus cellulolyticus NADH-quinone oxidoreductase subunit B (nuoB)

Ask
View Details